DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Orct2 and svopb

DIOPT Version :9

Sequence 1:NP_001262907.1 Gene:Orct2 / 42890 FlyBaseID:FBgn0086365 Length:567 Species:Drosophila melanogaster
Sequence 2:XP_021327288.1 Gene:svopb / 555216 ZFINID:ZDB-GENE-070705-359 Length:266 Species:Danio rerio


Alignment Length:241 Identity:59/241 - (24%)
Similarity:99/241 - (41%) Gaps:58/241 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   320 DQELDEGPPPSVWDLFCYPNLRRKTLLIFLDWLVTSGVYYGLSWNTSNL-----------GGNV- 372
            |...|.|   .:.||| .|..||.|||::..|..::.:||||...|:.|           ..|: 
Zfish    15 DNATDRG---RIKDLF-IPEYRRTTLLVWCIWFFSAFLYYGLVLLTTELFQAGSACGVTENSNIE 75

  Fly   373 --------------LLNFVISGAVEIPAYIFLLLTLNRWGRRSILCGCLVMAGLSLLATVIIPQR 423
                          .|:.:.:...|.|..:..|..:||..||..:..|     .||....|:|  
Zfish    76 HQCSLMCQHLTIDDYLDLLWTTFAEFPGLLVALWMVNRISRRKSMVIC-----FSLFTVCILP-- 133

  Fly   424 MHTLIVACA---------MLGKLAITASYGTVYIFSAEQFPTVVRNVALGAASMVARISGMMAPF 479
                :.||.         .:.:.:|.|.:...|:::.|.|||..|.:.:|.:|.::|:..::.| 
Zfish   134 ----LYACTHRIVLTVFIFIARTSINAGWQIAYVYTPEVFPTATRAIGIGTSSGMSRVGALVTP- 193

  Fly   480 LNFLATIWKPLPLLICGSLTLVAGLLSL----LLP-ETHNKPMLET 520
              |:|.:.....:.:..|:.|:.|||..    .|| ||..:.:.|:
Zfish   194 --FIAQVLLKSSVYLTLSVYLIFGLLGTAACWALPMETEGRSLQES 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Orct2NP_001262907.1 2A0119 11..520 CDD:273328 58/239 (24%)
MFS 127..503 CDD:119392 51/217 (24%)
svopbXP_021327288.1 Sugar_tr <23..236 CDD:331684 55/227 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.