| Sequence 1: | NP_651237.1 | Gene: | beta-PheRS / 42888 | FlyBaseID: | FBgn0039175 | Length: | 589 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001380012.1 | Gene: | Y54E10A.6 / 171890 | WormBaseID: | WBGene00021828 | Length: | 507 | Species: | Caenorhabditis elegans |
| Alignment Length: | 206 | Identity: | 70/206 - (33%) |
|---|---|---|---|
| Similarity: | 112/206 - (54%) | Gaps: | 17/206 - (8%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 112 PSTAQIRPYAVAAVLRNVTFTQA-SYNSFIDLQDKLHQN-ICRKRTLVAIGTHDLDTLQGPFSYE 174
Fly 175 ALAPDQIKFKPLNQTKEMTGSELMDFY-------------STHAQLKQYLPIIRESPVYPVIYDA 226
Fly 227 NRVVLSLPPIINGDHSKITLKTKNVFIECTATDRTKA-KVVLDTIVCLFSEHCAQKFTVEPCDVV 290
Fly 291 QPDGSVISYPE 301 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| beta-PheRS | NP_651237.1 | PLN02265 | 1..589 | CDD:215149 | 70/206 (34%) |
| B3_4 | 118..279 | CDD:214876 | 61/176 (35%) | ||
| B5 | 310..372 | CDD:281482 | |||
| PheRS_beta_core | 390..588 | CDD:238392 | |||
| Y54E10A.6 | NP_001380012.1 | LRR | <45..>219 | CDD:227223 | |
| leucine-rich repeat | 47..69 | CDD:275380 | |||
| leucine-rich repeat | 70..92 | CDD:275380 | |||
| leucine-rich repeat | 93..115 | CDD:275380 | |||
| leucine-rich repeat | 116..139 | CDD:275380 | |||
| leucine-rich repeat | 140..164 | CDD:275380 | |||
| leucine-rich repeat | 166..188 | CDD:275380 | |||
| leucine-rich repeat | 189..211 | CDD:275380 | |||
| PLN02265 | 266..>495 | CDD:215149 | 69/204 (34%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_COG0072 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D431403at33208 | |
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 1 | 1.000 | - | - | ||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 4 | 3.820 | |||||