DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spase22-23 and SPC3

DIOPT Version :9

Sequence 1:NP_001247279.1 Gene:Spase22-23 / 42885 FlyBaseID:FBgn0039172 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_013167.1 Gene:SPC3 / 850755 SGDID:S000004056 Length:184 Species:Saccharomyces cerevisiae


Alignment Length:136 Identity:51/136 - (37%)
Similarity:79/136 - (58%) Gaps:5/136 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 YRTDANINTVRVLVKNVPD---YGASREKHDLGF-VTFDLQTNLTGIFNWNVKQLFLYLTAEYQT 95
            :...:||:.|:.|: ||..   :|:.|.|..... :.|||.|:||.:||||.||:|:||||||.:
Yeast    40 FSVPSNIDNVKTLI-NVRTSRYFGSQRGKAKENMKIKFDLNTDLTPLFNWNTKQVFVYLTAEYNS 103

  Fly    96 PANQLNQVVLWDKIILRGDNAVLDFKNMNTKYYFWDDGNGLKDNRNVSLYLSWNIIPNAGLLPSV 160
            .....::|..|||||...|:||:|..::.:||..||..:|..:.:::...|.||:.|..|||...
Yeast   104 TEKITSEVTFWDKIIKSKDDAVIDVNDLRSKYSIWDIEDGKFEGKDLVFKLHWNVQPWVGLLTYG 168

  Fly   161 QATGKH 166
            :..|.:
Yeast   169 ETVGNY 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spase22-23NP_001247279.1 SPC22 4..172 CDD:282438 51/136 (38%)
SPC3NP_013167.1 SPC22 4..177 CDD:398327 51/136 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157346838
Domainoid 1 1.000 97 1.000 Domainoid score I1631
eggNOG 1 0.900 - - E1_KOG3372
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 97 1.000 Inparanoid score I1482
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002789
OrthoInspector 1 1.000 - - oto100397
orthoMCL 1 0.900 - - OOG6_102447
Panther 1 1.100 - - LDO PTHR12804
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1378
SonicParanoid 1 1.000 - - X1878
TreeFam 1 0.960 - -
1312.780

Return to query results.
Submit another query.