DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spase22-23 and AT5G27430

DIOPT Version :9

Sequence 1:NP_001247279.1 Gene:Spase22-23 / 42885 FlyBaseID:FBgn0039172 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_198095.1 Gene:AT5G27430 / 832802 AraportID:AT5G27430 Length:167 Species:Arabidopsis thaliana


Alignment Length:155 Identity:48/155 - (30%)
Similarity:88/155 - (56%) Gaps:7/155 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MHTVLTRGNATVAYTLSVLACLTFSCFLSTVFLDYRTDANINTVRVLVKNVPDYGASREKHDLGF 65
            ||:...|.||.:.:.:::||   |.|.::: |.|..::.| .:.::.:.|:..:......:|...
plant     1 MHSFGYRANALLTFAVTILA---FICAIAS-FSDNFSNQN-PSAQIQILNINWFQKQPHGNDEVS 60

  Fly    66 VTFDLQTNLTGIFNWNVKQLFLYLTAEYQTPANQLNQVVLWDKIILRGDNAVLDFKNMNTKYYFW 130
            :|.::..:|..:|.||.||:|.::.|||:|..|.||||.|||.||...::|.. :..::.||.|.
plant    61 LTLNITADLQSLFTWNTKQVFAFVAAEYETSKNALNQVSLWDAIIPEKEHAKF-WIQISNKYRFI 124

  Fly   131 DDGNGLKDNRNVSLYLSWNIIPNAG 155
            |.|:.|: .::.:|.|.|:::|..|
plant   125 DQGHNLR-GKDFNLTLHWHVMPKTG 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spase22-23NP_001247279.1 SPC22 4..172 CDD:282438 46/152 (30%)
AT5G27430NP_198095.1 SPC22 4..165 CDD:398327 46/152 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 85 1.000 Domainoid score I2821
eggNOG 1 0.900 - - E1_KOG3372
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41454
Inparanoid 1 1.050 89 1.000 Inparanoid score I2287
OMA 1 1.010 - - QHG54309
OrthoDB 1 1.010 - - D1514162at2759
OrthoFinder 1 1.000 - - FOG0002789
OrthoInspector 1 1.000 - - otm3560
orthoMCL 1 0.900 - - OOG6_102447
Panther 1 1.100 - - LDO PTHR12804
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1878
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.