DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spase22-23 and Arxes2

DIOPT Version :9

Sequence 1:NP_001247279.1 Gene:Spase22-23 / 42885 FlyBaseID:FBgn0039172 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_084099.1 Gene:Arxes2 / 76976 MGIID:1924226 Length:180 Species:Mus musculus


Alignment Length:174 Identity:90/174 - (51%)
Similarity:125/174 - (71%) Gaps:0/174 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MHTVLTRGNATVAYTLSVLACLTFSCFLSTVFLDYRTDANINTVRVLVKNVPDYGASREKHDLGF 65
            |:::|:|.|:..|:||||:|.||..|.|:|.|.|......::..|:|:|.|.|:...|:|.||||
Mouse     1 MNSLLSRANSLFAFTLSVMAALTLGCILTTAFKDRSAPVRLHVSRILLKKVEDFTGPRKKSDLGF 65

  Fly    66 VTFDLQTNLTGIFNWNVKQLFLYLTAEYQTPANQLNQVVLWDKIILRGDNAVLDFKNMNTKYYFW 130
            :||.:..:|...|:||||||||||:|||.|.:|.:|||||||||:|||:|..|:.|::.:||:|:
Mouse    66 ITFHISADLEKTFDWNVKQLFLYLSAEYSTKSNAVNQVVLWDKILLRGENPKLNLKDVKSKYFFF 130

  Fly   131 DDGNGLKDNRNVSLYLSWNIIPNAGLLPSVQATGKHLFKFPADY 174
            |||:|||.||||:|.|||.:||.||:||.|..:|:....||..|
Mouse   131 DDGHGLKGNRNVTLTLSWQVIPIAGILPLVTGSGRVSVPFPDSY 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spase22-23NP_001247279.1 SPC22 4..172 CDD:282438 87/167 (52%)
Arxes2NP_084099.1 SPC22 4..173 CDD:282438 88/168 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839814
Domainoid 1 1.000 207 1.000 Domainoid score I2873
eggNOG 1 0.900 - - E1_KOG3372
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 215 1.000 Inparanoid score I3603
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54309
OrthoDB 1 1.010 - - D1514162at2759
OrthoFinder 1 1.000 - - FOG0002789
OrthoInspector 1 1.000 - - otm44366
orthoMCL 1 0.900 - - OOG6_102447
Panther 1 1.100 - - O PTHR12804
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1878
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.770

Return to query results.
Submit another query.