DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spase22-23 and spcs3

DIOPT Version :9

Sequence 1:NP_001247279.1 Gene:Spase22-23 / 42885 FlyBaseID:FBgn0039172 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_001017094.2 Gene:spcs3 / 549848 XenbaseID:XB-GENE-950767 Length:180 Species:Xenopus tropicalis


Alignment Length:177 Identity:100/177 - (56%)
Similarity:132/177 - (74%) Gaps:0/177 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MHTVLTRGNATVAYTLSVLACLTFSCFLSTVFLDYRTDANINTVRVLVKNVPDYGASREKHDLGF 65
            |:|||:|.|:..|::|||:|.|||.||::|.|.:.....||:..||:::||.|:...||:.||||
 Frog     1 MNTVLSRANSLFAFSLSVMAALTFGCFITTAFKERIVPVNIHVSRVMLENVEDFTGPRERSDLGF 65

  Fly    66 VTFDLQTNLTGIFNWNVKQLFLYLTAEYQTPANQLNQVVLWDKIILRGDNAVLDFKNMNTKYYFW 130
            :|||:..:|..||:|||||||:||:|||.|.:|.||||||||||||||||..|..|.|.:||:|:
 Frog    66 ITFDINADLQPIFDWNVKQLFIYLSAEYATRSNTLNQVVLWDKIILRGDNPKLSLKEMKSKYFFF 130

  Fly   131 DDGNGLKDNRNVSLYLSWNIIPNAGLLPSVQATGKHLFKFPADYATS 177
            |||||||.|||::|.||||::||||:||.|..:|.....||..|.|:
 Frog   131 DDGNGLKGNRNITLTLSWNVVPNAGILPLVTGSGHISIPFPDTYKTT 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spase22-23NP_001247279.1 SPC22 4..172 CDD:282438 95/167 (57%)
spcs3NP_001017094.2 SPC22 4..173 CDD:368002 96/168 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 206 1.000 Domainoid score I2843
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41454
Inparanoid 1 1.050 215 1.000 Inparanoid score I3528
OMA 1 1.010 - - QHG54309
OrthoDB 1 1.010 - - D1514162at2759
OrthoFinder 1 1.000 - - FOG0002789
OrthoInspector 1 1.000 - - oto105612
Panther 1 1.100 - - LDO PTHR12804
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1878
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.080

Return to query results.
Submit another query.