DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spase22-23 and MGC109340

DIOPT Version :9

Sequence 1:NP_001247279.1 Gene:Spase22-23 / 42885 FlyBaseID:FBgn0039172 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_001019438.1 Gene:MGC109340 / 317409 RGDID:1563536 Length:180 Species:Rattus norvegicus


Alignment Length:174 Identity:91/174 - (52%)
Similarity:125/174 - (71%) Gaps:0/174 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MHTVLTRGNATVAYTLSVLACLTFSCFLSTVFLDYRTDANINTVRVLVKNVPDYGASREKHDLGF 65
            |:|:|:|.|:..|:||||:|.||..|.|:|.|.|......::..|:|:|.|.|:...|:|.||||
  Rat     1 MNTLLSRANSLFAFTLSVMAALTLGCILTTAFKDRSAPVRLHVSRILLKKVEDFTGPRKKSDLGF 65

  Fly    66 VTFDLQTNLTGIFNWNVKQLFLYLTAEYQTPANQLNQVVLWDKIILRGDNAVLDFKNMNTKYYFW 130
            :||.:..:|...|:||||||||||:|||.|.:|.:|||||||||:|||:|..|:.|::.:||:|:
  Rat    66 ITFHISADLEKTFDWNVKQLFLYLSAEYSTKSNAVNQVVLWDKILLRGENPKLNLKDVKSKYFFF 130

  Fly   131 DDGNGLKDNRNVSLYLSWNIIPNAGLLPSVQATGKHLFKFPADY 174
            |||:|||.||||:|.|||.:||.||:||.|..:|:....||..|
  Rat   131 DDGHGLKGNRNVTLTLSWQVIPIAGILPLVTGSGRVSVPFPDSY 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spase22-23NP_001247279.1 SPC22 4..172 CDD:282438 87/167 (52%)
MGC109340NP_001019438.1 SPC22 4..173 CDD:398327 88/168 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343654
Domainoid 1 1.000 207 1.000 Domainoid score I2788
eggNOG 1 0.900 - - E1_KOG3372
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 215 1.000 Inparanoid score I3531
OMA 1 1.010 - - QHG54309
OrthoDB 1 1.010 - - D1514162at2759
OrthoFinder 1 1.000 - - FOG0002789
OrthoInspector 1 1.000 - - otm46463
orthoMCL 1 0.900 - - OOG6_102447
Panther 1 1.100 - - O PTHR12804
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1878
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1312.900

Return to query results.
Submit another query.