DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spase22-23 and spc3

DIOPT Version :9

Sequence 1:NP_001247279.1 Gene:Spase22-23 / 42885 FlyBaseID:FBgn0039172 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_593225.1 Gene:spc3 / 2543318 PomBaseID:SPAC56F8.11 Length:185 Species:Schizosaccharomyces pombe


Alignment Length:175 Identity:41/175 - (23%)
Similarity:82/175 - (46%) Gaps:9/175 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TVLTRGNATVAYTLSVL----ACLTFSCFLSTVFLDYRTDANINTVRVLVKNVPDYGASRE-KHD 62
            |...||:...:...:||    |.:||...:....::..|...::..:  .::...|.|.|. :..
pombe     5 TFTNRGSTFFSKLSTVLFFLCAVITFQGVIQRREVELDTPVYVHYAK--YRSARFYHAFRNVRQQ 67

  Fly    63 LGFVTFDLQTNLTGIFNWNVKQLFLYLTAEYQTPANQLNQVVLWDKIILRGDNAVLDFKN--MNT 125
            ...|.|::..:|:.:::||.|.:.:||.|.|.|..::.||||:||||:...:.:.:..|:  .|.
pombe    68 YAQVKFNMDADLSELWDWNTKHVVVYLVASYSTEKHEKNQVVVWDKILSSPEESKMFMKDTLSNI 132

  Fly   126 KYYFWDDGNGLKDNRNVSLYLSWNIIPNAGLLPSVQATGKHLFKF 170
            :.:.:::.:...:.:|.:..|.|.:.|..|.|......|.:...|
pombe   133 QAHPFNEYSNQFEGKNATYTLHWTVSPKMGFLSWGAGPGSYEIPF 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spase22-23NP_001247279.1 SPC22 4..172 CDD:282438 40/174 (23%)
spc3NP_593225.1 SPC22 6..177 CDD:282438 39/172 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 60 1.000 Domainoid score I3030
eggNOG 1 0.900 - - E1_KOG3372
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 59 1.000 Inparanoid score I2002
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002789
OrthoInspector 1 1.000 - - oto102176
orthoMCL 1 0.900 - - OOG6_102447
Panther 1 1.100 - - LDO PTHR12804
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1378
SonicParanoid 1 1.000 - - X1878
TreeFam 1 0.960 - -
1211.850

Return to query results.
Submit another query.