DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spps and FZF1

DIOPT Version :9

Sequence 1:NP_001262902.1 Gene:Spps / 42882 FlyBaseID:FBgn0039169 Length:985 Species:Drosophila melanogaster
Sequence 2:NP_011260.1 Gene:FZF1 / 852638 SGDID:S000003223 Length:299 Species:Saccharomyces cerevisiae


Alignment Length:251 Identity:60/251 - (23%)
Similarity:91/251 - (36%) Gaps:51/251 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   736 KKRQHICHITGCHKVYGKTSHLRAHLRWHTGERPFVCSWAFCGKRFTRSDELQRHRRTHTGEKRF 800
            |.|.:.|...||.|||.:.|.|:.|...||.::|:.|....|||:|.|...|:.|:.||:..|..
Yeast     8 KSRNYKCSFDGCEKVYNRPSLLQQHQNSHTNQKPYHCDEPGCGKKFIRPCHLRVHKWTHSQIKPK 72

  Fly   801 QCQECNKKFMRSDHLSKHIKTHFKSRSGVELIELSIKQETKGGNAPKSISTVNGIVTIEIPGGGS 865
            .|..|.|:|:.:..|.:|:.:|  .|.......:..|.|....|....::...|....::| .||
Yeast    73 ACTLCQKRFVTNQQLRRHLNSH--ERKSKLASRIDRKHEGVNANVKAELNGKEGGFDPKLP-SGS 134

  Fly   866 AAAGSGASS---------------------------------VAATVAGSTVTPGGATIVQ--LP 895
            ...|...|.                                 :...:|...|.|.|...::  ||
Yeast   135 PMCGEEFSQGHLPGYDDMQVLQCPYKSCQKVTSFNDDLINHMLQHHIASKLVVPSGDPSLKESLP 199

  Fly   896 TVEASGGGD-------SF---GDDEDDEEDDELTEEDDEDEELDEDDM---DDCED 938
            |.|.|...|       ||   |....:..|....:...:.|....|:.   .||::
Yeast   200 TSEKSSSTDTTSIPQLSFSTTGTSSSESVDSTTAQTPTDPESYWSDNRCKHSDCQE 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SppsNP_001262902.1 COG5048 <725..827 CDD:227381 32/90 (36%)
C2H2 Zn finger 742..764 CDD:275368 9/21 (43%)
zf-H2C2_2 756..783 CDD:290200 10/26 (38%)
C2H2 Zn finger 772..794 CDD:275368 8/21 (38%)
zf-H2C2_2 786..809 CDD:290200 8/22 (36%)
zf-C2H2 800..822 CDD:278523 6/21 (29%)
C2H2 Zn finger 802..822 CDD:275368 6/19 (32%)
FZF1NP_011260.1 COG5048 15..297 CDD:227381 57/244 (23%)
C2H2 Zn finger 17..36 CDD:275368 8/18 (44%)
C2H2 Zn finger 44..66 CDD:275368 8/21 (38%)
C2H2 Zn finger 74..94 CDD:275368 6/19 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000436
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.