DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spps and Sp6

DIOPT Version :9

Sequence 1:NP_001262902.1 Gene:Spps / 42882 FlyBaseID:FBgn0039169 Length:985 Species:Drosophila melanogaster
Sequence 2:NP_001350159.1 Gene:Sp6 / 83395 MGIID:1932575 Length:376 Species:Mus musculus


Alignment Length:457 Identity:136/457 - (29%)
Similarity:183/457 - (40%) Gaps:118/457 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   453 LTVIPAQLRPNAPTAPTPAPAGVPTPMQMPNLQALPIQNIPGLGQVQIIHANQLPPNLPANFQQ- 516
            ||.:...|......||..:|         |.|...|:|...|       |.:....:.|:..|. 
Mouse     2 LTAVCGSLGSQHTDAPHASP---------PRLDLQPLQTYQG-------HTSPEAGDYPSPLQPG 50

  Fly   517 VLTQLPMSHPQVQ-TQGQVQVMPKQEPQSPTQMIT--SIKQEPPDTFGPISATGNPPAPASTPNT 578
            .|..||:. |:|. :||       .|....:..:|  .::.:.|...||.|       ....|:.
Mouse    51 ELQSLPLG-PEVDFSQG-------YELPGASSRVTCEDLESDSPLAPGPFS-------KLLQPDM 100

  Fly   579 ASPQQQQIKFLH--TESNSLSSLSIPASIQITALPQQATNTPNTPATTQP----------IPVSL 631
            :...:...:..|  ||..|...|....|.......|.|..:|..|...||          :....
Mouse   101 SHHYESWFRPTHPGTEDGSWWDLHPGTSWMDLPHTQGALTSPGHPGALQPALGGYVGDHQLCAPP 165

  Fly   632 PARSKVNAVTTSSTQITIAPTGG--QVVSVTTQARGATASIRSTNTSTTTITTPSQSHLNMNISV 694
            |.....:.:..:..|..:.|..|  .:.:...:::|..:|:                        
Mouse   166 PHPHPHHLLPAAGGQHLLGPPDGAKALEAAAQESQGLDSSL------------------------ 206

  Fly   695 ASVGGAATGGGGGTATGEPK------PRLK-RVACTCPNCTDGEK--------HSDKKRQHICHI 744
                         .|...||      ||.. :..|.||||.:.|:        ...||..|.|||
Mouse   207 -------------DAASRPKGSRRSVPRSSGQTVCRCPNCLEAERLGAPCGPDGGKKKHLHNCHI 258

  Fly   745 TGCHKVYGKTSHLRAHLRWHTGERPFVCSWAFCGKRFTRSDELQRHRRTHTGEKRFQCQECNKKF 809
            .||.|.|.|||||:||||||:|:|||||:|.|||||||||||||||.:||||.|:|.|..|::.|
Mouse   259 PGCGKAYAKTSHLKAHLRWHSGDRPFVCNWLFCGKRFTRSDELQRHLQTHTGTKKFPCAVCSRVF 323

  Fly   810 MRSDHLSKHIKTHFKSRSGVELIELSIKQETKGGNAPKSISTVNGIVTIEIPGGGS--AAAGSGA 872
            ||||||:||:|||   ....|....:.:.|.|.|          |:|  |.|||..  .|.||.|
Mouse   324 MRSDHLAKHMKTH---EGAKEEAAAAAQGEGKAG----------GVV--EPPGGKGKREAEGSSA 373

  Fly   873 SS 874
            ||
Mouse   374 SS 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SppsNP_001262902.1 COG5048 <725..827 CDD:227381 67/109 (61%)
C2H2 Zn finger 742..764 CDD:275368 16/21 (76%)
zf-H2C2_2 756..783 CDD:290200 21/26 (81%)
C2H2 Zn finger 772..794 CDD:275368 17/21 (81%)
zf-H2C2_2 786..809 CDD:290200 13/22 (59%)
zf-C2H2 800..822 CDD:278523 13/21 (62%)
C2H2 Zn finger 802..822 CDD:275368 12/19 (63%)
Sp6NP_001350159.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..70 22/91 (24%)
9aaTAD. /evidence=ECO:0000250|UniProtKB:Q3SY56 118..126 2/7 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 164..224 11/96 (11%)
C2H2 Zn finger 259..278 CDD:275368 13/18 (72%)
COG5048 <261..>336 CDD:227381 54/74 (73%)
C2H2 Zn finger 286..308 CDD:275368 17/21 (81%)
C2H2 Zn finger 316..336 CDD:275368 12/19 (63%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 334..376 19/57 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1085860at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23235
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.