DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spps and klf13

DIOPT Version :9

Sequence 1:NP_001262902.1 Gene:Spps / 42882 FlyBaseID:FBgn0039169 Length:985 Species:Drosophila melanogaster
Sequence 2:NP_001070240.1 Gene:klf13 / 767805 ZFINID:ZDB-GENE-060929-1274 Length:258 Species:Danio rerio


Alignment Length:258 Identity:98/258 - (37%)
Similarity:123/258 - (47%) Gaps:45/258 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   640 VTTSSTQITIAPTGGQVVSVTT---QARGATASIRSTNTSTTTIT----------TPSQSHLNMN 691
            |:.||..|...|.|.:.....|   |..|..|.....:.|:..:.          ||:.......
Zfish    10 VSMSSQAIVHGPKGNRETKPETAAAQRNGEEAKEPLKDNSSLFVVARILADFNQQTPASFAEQAK 74

  Fly   692 ISVASVGGAAT----GGGGGTATGEP-----KPRLKRVACTCPNCTDGE-KHSDKKRQHICHITG 746
            |...|....||    .|...|.|..|     |.|.||..        |. :|...:::|.||.:|
Zfish    75 IKEESTPPTATPSGDDGNSATPTAIPGDSALKQRGKRFR--------GRVEHDAPQKKHKCHYSG 131

  Fly   747 CHKVYGKTSHLRAHLRWHTGERPFVCSWAFCGKRFTRSDELQRHRRTHTGEKRFQCQECNKKFMR 811
            |.|||||:|||:||||.|||||||.|:|..|.|:|.|||||.||.|||||||:|.|..|:|:|||
Zfish   132 CEKVYGKSSHLKAHLRTHTGERPFPCTWPDCSKKFARSDELARHYRTHTGEKKFGCPLCDKRFMR 196

  Fly   812 SDHLSKHIKTHFKSRSGVELIELSIKQETKGGNAPKSISTVNGIVTIEIPGGGSAAAGSGASS 874
            ||||.||.:.|...:..:      :|::..||||..|.|.        .||..|..:.|.|||
Zfish   197 SDHLMKHARRHSDFQPAM------LKRQHGGGNAAVSSSM--------RPGSLSDYSRSDASS 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SppsNP_001262902.1 COG5048 <725..827 CDD:227381 59/102 (58%)
C2H2 Zn finger 742..764 CDD:275368 16/21 (76%)
zf-H2C2_2 756..783 CDD:290200 18/26 (69%)
C2H2 Zn finger 772..794 CDD:275368 13/21 (62%)
zf-H2C2_2 786..809 CDD:290200 15/22 (68%)
zf-C2H2 800..822 CDD:278523 13/21 (62%)
C2H2 Zn finger 802..822 CDD:275368 12/19 (63%)
klf13NP_001070240.1 zf-C2H2_8 127..209 CDD:292531 56/81 (69%)
C2H2 Zn finger 127..149 CDD:275368 16/21 (76%)
zf-H2C2_2 141..168 CDD:290200 18/26 (69%)
C2H2 Zn finger 157..179 CDD:275368 13/21 (62%)
zf-H2C2_2 171..194 CDD:290200 15/22 (68%)
C2H2 Zn finger 187..207 CDD:275368 12/19 (63%)
zf-C2H2 187..207 CDD:278523 12/19 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.