DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spps and KLF10

DIOPT Version :9

Sequence 1:NP_001262902.1 Gene:Spps / 42882 FlyBaseID:FBgn0039169 Length:985 Species:Drosophila melanogaster
Sequence 2:NP_005646.1 Gene:KLF10 / 7071 HGNCID:11810 Length:480 Species:Homo sapiens


Alignment Length:535 Identity:133/535 - (24%)
Similarity:217/535 - (40%) Gaps:127/535 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   387 QQVQQQQQQQQAQQQQQAQQQQAQQQQQQQVQAQHQQLLQAISDASAGGQLPPNQPITITNAQGQ 451
            ||..:::.:..:::.:::.....:..::...:|....:..:.|..|...:...|:|:|..:...:
Human     9 QQTAEERMEMISERPKESMYSWNKTAEKSDFEAVEALMSMSCSWKSDFKKYVENRPVTPVSDLSE 73

  Fly   452 QLTVIPAQLRPNAPTAP----TP--APAGVPTPMQMPNLQALPIQNIPGLGQVQIIHANQL---- 506
            :..::|.  .|:..|.|    ||  :|:.. .|.|:.||.| |..:        .:|...|    
Human    74 EENLLPG--TPDFHTIPAFCLTPPYSPSDF-EPSQVSNLMA-PAPS--------TVHFKSLSDTA 126

  Fly   507 PPNLPANFQQVLTQLPMSHPQVQTQGQVQVMPKQEPQSPTQMITSIKQEPPDT------FGPISA 565
            .|::.|.|:                 :.:..|...|:.|....||:.:...|.      ..|:.|
Human   127 KPHIAAPFK-----------------EEEKSPVSAPKLPKAQATSVIRHTADAQLCNHQTCPMKA 174

  Fly   566 TG----------------------NPPAPASTPNTASPQQQQIKFLHTE-SNSLSSLSIPASIQI 607
            ..                      |.|..|.:||.:..::..:..:..: |.:|...|:|:|..:
Human   175 ASILNYQNNSFRRRTHLNVEAARKNIPCAAVSPNRSKCERNTVADVDEKASAALYDFSVPSSETV 239

  Fly   608 -------TALPQQATNTPNTPATT----QPIP-----VSLPARSKVNAVTTSSTQITIAP-TGGQ 655
                   ...|||.:...:.||.:    .|:|     |.|||.:.|......||..:..| ....
Human   240 ICRSQPAPVSPQQKSVLVSPPAVSAGGVPPMPVICQMVPLPANNPVVTTVVPSTPPSQPPAVCPP 304

  Fly   656 VVSVTTQA-RGATASI---RSTNTSTTTITTPSQSHLNMNISVASVGGAATGGGGGTATGEPKPR 716
            ||.:.||. :||...:   ....:|...:.:|:.:.|:         ..|...|...:..:..|:
Human   305 VVFMGTQVPKGAVMFVVPQPVVQSSKPPVVSPNGTRLS---------PIAPAPGFSPSAAKVTPQ 360

  Fly   717 LKRVACTCPNCTDGEKHSDKKRQHICHITGCHKVYGKTSHLRAHLRWHTGERPFVCSWAFCGKRF 781
            :               .|.:.|.|||...||.|.|.|:|||:||.|.||||:||.|||..|.:||
Human   361 I---------------DSSRIRSHICSHPGCGKTYFKSSHLKAHTRTHTGEKPFSCSWKGCERRF 410

  Fly   782 TRSDELQRHRRTHTGEKRFQCQECNKKFMRSDHLSKHIKTHFKSRSGVELIELSIKQETKGGNAP 846
            .|||||.||||||||||:|.|..|:::|||||||:||.:.|..::              |..|..
Human   411 ARSDELSRHRRTHTGEKKFACPMCDRRFMRSDHLTKHARRHLSAK--------------KLPNWQ 461

  Fly   847 KSISTVNGIVTIEIP 861
            ..:|.:|.|.....|
Human   462 MEVSKLNDIALPPTP 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SppsNP_001262902.1 COG5048 <725..827 CDD:227381 56/101 (55%)
C2H2 Zn finger 742..764 CDD:275368 12/21 (57%)
zf-H2C2_2 756..783 CDD:290200 17/26 (65%)
C2H2 Zn finger 772..794 CDD:275368 15/21 (71%)
zf-H2C2_2 786..809 CDD:290200 15/22 (68%)
zf-C2H2 800..822 CDD:278523 12/21 (57%)
C2H2 Zn finger 802..822 CDD:275368 11/19 (58%)
KLF10NP_005646.1 zf-C2H2 369..393 CDD:278523 14/23 (61%)
COG5048 374..>424 CDD:227381 33/49 (67%)
C2H2 Zn finger 374..393 CDD:275368 11/18 (61%)
zf-H2C2_2 385..412 CDD:290200 17/26 (65%)
C2H2 Zn finger 401..423 CDD:275368 15/21 (71%)
zf-H2C2_2 415..438 CDD:290200 15/22 (68%)
zf-C2H2 429..451 CDD:278523 12/21 (57%)
C2H2 Zn finger 431..451 CDD:275368 11/19 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6780
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.