DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spps and CG3065

DIOPT Version :9

Sequence 1:NP_001262902.1 Gene:Spps / 42882 FlyBaseID:FBgn0039169 Length:985 Species:Drosophila melanogaster
Sequence 2:NP_611861.1 Gene:CG3065 / 37818 FlyBaseID:FBgn0034946 Length:400 Species:Drosophila melanogaster


Alignment Length:254 Identity:89/254 - (35%)
Similarity:118/254 - (46%) Gaps:53/254 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   618 PNTP-----ATTQPI-----PVSLPARSKVNAVTTSSTQITIAPTGGQVVSVTTQARGATASIRS 672
            ||||     .|:.||     |.:.|..|..|....:|..|..|.|      :....:...|::.:
  Fly     6 PNTPTPQMLTTSTPIEPMKPPPAFPTMSGANIHEQASDMILRAST------IFEDVKHDEANVEN 64

  Fly   673 TNTSTTTITTPSQSHLNMNISVASVGGAATGGGGGTATGEPKPRLKRVACTCPNCTDGEKHSDKK 737
            .............||.               ||.|.:.....|.:|.:|.|..        ||.|
  Fly    65 VPHHGVETEPEDDSHY---------------GGNGNSKIRIMPSVKLMATTLA--------SDPK 106

  Fly   738 RQHICHITGCHKVYGKTSHLRAHLRWHTGERPFVCSWAFCGKRFTRSDELQRHRRTHTGEKRFQC 802
            |:.:|....|.|.|||:||||:||.||||.:|||||...|||.|||||||.||.|||||||.|:|
  Fly   107 RKFVCPYDNCTKSYGKSSHLRSHLTWHTGIKPFVCSEPKCGKGFTRSDELNRHLRTHTGEKPFEC 171

  Fly   803 QECNKKFMRSDHLSKHIKTHFKSRSGVELIELSIKQETKGGNAPKSISTVNGIVTIEIP 861
            .:|.|||.|||||:||:.||              .::.||....:::.:.:|.|.::.|
  Fly   172 IQCTKKFSRSDHLTKHLATH--------------DRQLKGSTPKRTVPSSSGGVRLKPP 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SppsNP_001262902.1 COG5048 <725..827 CDD:227381 59/101 (58%)
C2H2 Zn finger 742..764 CDD:275368 12/21 (57%)
zf-H2C2_2 756..783 CDD:290200 18/26 (69%)
C2H2 Zn finger 772..794 CDD:275368 15/21 (71%)
zf-H2C2_2 786..809 CDD:290200 15/22 (68%)
zf-C2H2 800..822 CDD:278523 13/21 (62%)
C2H2 Zn finger 802..822 CDD:275368 12/19 (63%)
CG3065NP_611861.1 COG5048 99..>400 CDD:227381 65/140 (46%)
C2H2 Zn finger 111..133 CDD:275368 12/21 (57%)
zf-C2H2 139..163 CDD:278523 17/23 (74%)
C2H2 Zn finger 141..163 CDD:275368 15/21 (71%)
zf-H2C2_2 155..180 CDD:290200 17/24 (71%)
C2H2 Zn finger 171..191 CDD:275368 12/19 (63%)
zf-C2H2 346..368 CDD:278523
C2H2 Zn finger 348..368 CDD:275368
zf-H2C2_2 360..385 CDD:290200
C2H2 Zn finger 376..396 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BGI1
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23235
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.