| Sequence 1: | NP_001262902.1 | Gene: | Spps / 42882 | FlyBaseID: | FBgn0039169 | Length: | 985 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_611747.2 | Gene: | CG42741 / 37654 | FlyBaseID: | FBgn0261705 | Length: | 362 | Species: | Drosophila melanogaster |
| Alignment Length: | 202 | Identity: | 72/202 - (35%) |
|---|---|---|---|
| Similarity: | 101/202 - (50%) | Gaps: | 22/202 - (10%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 635 SKVNAVTTSSTQITIAPTGGQVVSVTTQARGATASIRSTNT-STTTITTPSQSHLNMNISVASVG 698
Fly 699 GAATG-----------GGGGTATGEPKPRLKRVACTCPNCTDGEKH--SDKKRQHICHITGCHKV 750
Fly 751 YGKTSHLRAHLRWHTGERPFVCSWAFCGKRFTRSDELQRHRRTHTGEKRFQCQECNKKFMRSDHL 815
Fly 816 SKHIKTH 822 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Spps | NP_001262902.1 | COG5048 | <725..827 | CDD:227381 | 52/100 (52%) |
| C2H2 Zn finger | 742..764 | CDD:275368 | 13/21 (62%) | ||
| zf-H2C2_2 | 756..783 | CDD:290200 | 16/26 (62%) | ||
| C2H2 Zn finger | 772..794 | CDD:275368 | 13/21 (62%) | ||
| zf-H2C2_2 | 786..809 | CDD:290200 | 13/22 (59%) | ||
| zf-C2H2 | 800..822 | CDD:278523 | 12/21 (57%) | ||
| C2H2 Zn finger | 802..822 | CDD:275368 | 11/19 (58%) | ||
| CG42741 | NP_611747.2 | COG5048 | <273..>352 | CDD:227381 | 43/78 (55%) |
| zf-C2H2 | 280..304 | CDD:278523 | 14/23 (61%) | ||
| C2H2 Zn finger | 282..304 | CDD:275368 | 13/21 (62%) | ||
| zf-H2C2_2 | 296..>313 | CDD:290200 | 11/16 (69%) | ||
| C2H2 Zn finger | 312..334 | CDD:275368 | 13/21 (62%) | ||
| zf-H2C2_2 | 326..351 | CDD:290200 | 14/24 (58%) | ||
| C2H2 Zn finger | 342..362 | CDD:275368 | 11/19 (58%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 1 | 1.000 | - | - | FOG0000436 | |
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | P | PTHR23235 |
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 3 | 3.010 | |||||