DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Spps and ZK686.5

DIOPT Version :9

Sequence 1:	NP_001262902.1	Gene:	Spps / 42882	FlyBaseID:	FBgn0039169	Length:	985	Species:	Drosophila melanogaster
Sequence 2:	NP_001023030.2	Gene:	ZK686.5 / 3565160	WormBaseID:	WBGene00022795	Length:	263	Species:	Caenorhabditis elegans

Alignment Length:	108	Identity:	27/108 - (25%)
Similarity:	43/108 - (39%)	Gaps:	20/108 - (18%)

- Green bases have known domain annotations that are detailed below.

  Fly   726 NC-TDGEKHSDKKRQH----------ICHITGCHKVYGKTSHLRAHLRWHTGERPFV-CSWAFCG 778
            || .|.||...:|...          .|.:  |.:.:..:..|..| |......|:: |.  .|.
Worm   146 NCGIDNEKQDREKAMKRKVTETIVTTYCEL--CEQNFSSSKMLLLH-RGKVHNTPYIECH--LCM 205

  Fly   779 KRFTRSDELQRHRRTHTGEKR---FQCQECNKKFMRSDHLSKH 818
            |.|:::.:..||.:||.|...   .||:.|:::|.....|..|
Worm   206 KLFSQTIQFNRHMKTHYGPNAKIYVQCELCDRQFKDKQSLRTH 248

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Spps	NP_001262902.1	COG5048	<725..827	CDD:227381	27/108 (25%)
		C2H2 Zn finger	742..764	CDD:275368	5/21 (24%)
		zf-H2C2_2	756..783	CDD:290200	8/27 (30%)
		C2H2 Zn finger	772..794	CDD:275368	6/21 (29%)
		zf-H2C2_2	786..809	CDD:290200	8/25 (32%)
		zf-C2H2	800..822	CDD:278523	6/19 (32%)
		C2H2 Zn finger	802..822	CDD:275368	5/17 (29%)
ZK686.5	NP_001023030.2	C2H2 Zn finger	173..194	CDD:275368	5/23 (22%)
		C2H2 Zn finger	201..221	CDD:275368	6/21 (29%)
		zf-C2H2_8	<204..251	CDD:292531	14/45 (31%)
		C2H2 Zn finger	232..248	CDD:275368	4/15 (27%)

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	0	0.000