DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spps and SP8

DIOPT Version :9

Sequence 1:NP_001262902.1 Gene:Spps / 42882 FlyBaseID:FBgn0039169 Length:985 Species:Drosophila melanogaster
Sequence 2:NP_874359.2 Gene:SP8 / 221833 HGNCID:19196 Length:508 Species:Homo sapiens


Alignment Length:296 Identity:120/296 - (40%)
Similarity:144/296 - (48%) Gaps:80/296 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   618 PNTPATTQPIPVSL-PARSKVNAVTTSSTQITIAPTGGQVVSVTTQARGATASIRSTNTSTTTIT 681
            ||:.|.   :|.|| ||...:.....|       |.||    ..:...|.:.|..|:..| :.:.
Human   241 PNSAAA---LPGSLHPAAGGLQTSLHS-------PLGG----YNSDYSGLSHSAFSSGAS-SHLL 290

  Fly   682 TPSQSHL--------------NMNISVASVGGAATGGG-----GGTATGEPKPRLKRVACTCPNC 727
            :|:..||              :....:|..||:....|     ||:.....:....|..|.||||
Human   291 SPAGQHLMDGFKPVLPGSYPDSAPSPLAGAGGSMLSAGPSAPLGGSPRSSARRYSGRATCDCPNC 355

  Fly   728 TDGEKHSD------KKRQHICHITGCHKVYGKTSHLRAHLRWHTGERPFVCSWAFCGKRFTRSDE 786
            .:.|:...      :|..|.|||.||.|||||||||:||||||||||||||:|.|||||||||||
Human   356 QEAERLGPAGASLRRKGLHSCHIPGCGKVYGKTSHLKAHLRWHTGERPFVCNWLFCGKRFTRSDE 420

  Fly   787 LQRHRRTHTGEKRFQCQECNKKFMRSDHLSKHIKTHFKSRSGVELIELSIKQETKGGNAPKSIST 851
            ||||.|||||||||.|..|||:||||||||||:|||    ||             ||.       
Human   421 LQRHLRTHTGEKRFACPVCNKRFMRSDHLSKHVKTH----SG-------------GGG------- 461

  Fly   852 VNGIVTIEIPGGGSAAAGSGASSVAAT-----VAGS 882
                      |||||.:|||....:.|     .|||
Human   462 ----------GGGSAGSGSGGKKGSDTDSEHSAAGS 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SppsNP_001262902.1 COG5048 <725..827 CDD:227381 76/107 (71%)
C2H2 Zn finger 742..764 CDD:275368 18/21 (86%)
zf-H2C2_2 756..783 CDD:290200 23/26 (88%)
C2H2 Zn finger 772..794 CDD:275368 18/21 (86%)
zf-H2C2_2 786..809 CDD:290200 18/22 (82%)
zf-C2H2 800..822 CDD:278523 16/21 (76%)
C2H2 Zn finger 802..822 CDD:275368 15/19 (79%)
SP8NP_874359.2 C2H2 Zn finger 379..398 CDD:275368 15/18 (83%)
COG5048 <389..456 CDD:227381 57/66 (86%)
zf-H2C2_2 390..417 CDD:290200 23/26 (88%)
C2H2 Zn finger 406..428 CDD:275368 18/21 (86%)
zf-H2C2_2 420..443 CDD:290200 18/22 (82%)
zf-C2H2 434..456 CDD:278523 16/21 (76%)
C2H2 Zn finger 436..456 CDD:275368 15/19 (79%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23235
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.