DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spps and sptf-2

DIOPT Version :9

Sequence 1:NP_001262902.1 Gene:Spps / 42882 FlyBaseID:FBgn0039169 Length:985 Species:Drosophila melanogaster
Sequence 2:NP_495833.1 Gene:sptf-2 / 188733 WormBaseID:WBGene00011926 Length:166 Species:Caenorhabditis elegans


Alignment Length:154 Identity:71/154 - (46%)
Similarity:93/154 - (60%) Gaps:11/154 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   676 STTTITTPSQSHLNMNISVASVG-----GAATGGGGGTATGEPKPRLKR---VACTCPNCTDGEK 732
            :.|....|.:||.:.:.|:.|:.     .:.:.....::.|..:...||   ..|||||| ...|
 Worm     4 AATKFFRPWESHGSYHHSLPSISPPDSPASTSASSSSSSIGANELTTKRRKCERCTCPNC-KAIK 67

  Fly   733 HSDKKRQ--HICHITGCHKVYGKTSHLRAHLRWHTGERPFVCSWAFCGKRFTRSDELQRHRRTHT 795
            |.|:..|  |:|.:.||.|.|.||||||||||.|||:|||||.|..|||||.|||:|.||:||||
 Worm    68 HGDRGSQHTHLCSVPGCGKTYKKTSHLRAHLRKHTGDRPFVCDWFDCGKRFDRSDQLIRHKRTHT 132

  Fly   796 GEKRFQCQECNKKFMRSDHLSKHI 819
            .|.||.|:.|.::|.|||||.:|:
 Worm   133 KEYRFACKFCIRQFSRSDHLQQHL 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SppsNP_001262902.1 COG5048 <725..827 CDD:227381 59/97 (61%)
C2H2 Zn finger 742..764 CDD:275368 15/21 (71%)
zf-H2C2_2 756..783 CDD:290200 21/26 (81%)
C2H2 Zn finger 772..794 CDD:275368 14/21 (67%)
zf-H2C2_2 786..809 CDD:290200 12/22 (55%)
zf-C2H2 800..822 CDD:278523 10/20 (50%)
C2H2 Zn finger 802..822 CDD:275368 9/18 (50%)
sptf-2NP_495833.1 COG5048 <75..156 CDD:227381 51/80 (64%)
C2H2 Zn finger 82..101 CDD:275368 14/18 (78%)
C2H2 Zn finger 109..131 CDD:275368 14/21 (67%)
C2H2 Zn finger 139..156 CDD:275368 8/16 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D454837at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm14601
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23235
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6780
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
66.050

Return to query results.
Submit another query.