DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spps and klf-2

DIOPT Version :9

Sequence 1:NP_001262902.1 Gene:Spps / 42882 FlyBaseID:FBgn0039169 Length:985 Species:Drosophila melanogaster
Sequence 2:NP_507995.2 Gene:klf-2 / 186179 WormBaseID:WBGene00009998 Length:299 Species:Caenorhabditis elegans


Alignment Length:116 Identity:57/116 - (49%)
Similarity:69/116 - (59%) Gaps:12/116 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   709 ATGEPK--PRLKRVACTCPNCTDGEKHSDKKRQHICHITGCHKVYGKTSHLRAHLRWHTGERPFV 771
            :|.:||  |..:|...|.          |:.|.|.|...||.|||.|:|||.||.|.|:||:|:.
 Worm   175 STEKPKKVPSKRRDKATL----------DRLRVHKCFYQGCGKVYTKSSHLTAHERVHSGEKPYP 229

  Fly   772 CSWAFCGKRFTRSDELQRHRRTHTGEKRFQCQECNKKFMRSDHLSKHIKTH 822
            |.|..|..||.|||||.||.|.|||.|.|.|:||::||.|||||..|:|.|
 Worm   230 CEWPGCSWRFARSDELTRHYRKHTGAKPFACKECSRKFSRSDHLQLHMKRH 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SppsNP_001262902.1 COG5048 <725..827 CDD:227381 51/98 (52%)
C2H2 Zn finger 742..764 CDD:275368 13/21 (62%)
zf-H2C2_2 756..783 CDD:290200 14/26 (54%)
C2H2 Zn finger 772..794 CDD:275368 13/21 (62%)
zf-H2C2_2 786..809 CDD:290200 13/22 (59%)
zf-C2H2 800..822 CDD:278523 13/21 (62%)
C2H2 Zn finger 802..822 CDD:275368 12/19 (63%)
klf-2NP_507995.2 C2H2 Zn finger 205..222 CDD:275368 11/16 (69%)
C2H2 Zn finger 230..252 CDD:275368 13/21 (62%)
zf-H2C2_2 244..269 CDD:290200 15/24 (63%)
C2H2 Zn finger 260..280 CDD:275368 12/19 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000436
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6780
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.