DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spps and sp5l

DIOPT Version :9

Sequence 1:NP_001262902.1 Gene:Spps / 42882 FlyBaseID:FBgn0039169 Length:985 Species:Drosophila melanogaster
Sequence 2:XP_012811854.1 Gene:sp5l / 100135216 XenbaseID:XB-GENE-1000647 Length:344 Species:Xenopus tropicalis


Alignment Length:432 Identity:130/432 - (30%)
Similarity:179/432 - (41%) Gaps:133/432 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   412 QQQQQVQAQHQQLLQAISDASAGGQLP-----PNQPITITNAQGQQLTVIPAQLRPNAPTA---- 467
            |:...:||..|.  :..|.:..||.|.     |:..:.:..|:........:...|.||||    
 Frog     7 QRDNTLQAYLQD--RTPSSSPEGGLLSSLALFPSTCVPVITAKPAPREYTQSAYDPVAPTAGMFQ 69

  Fly   468 ----PTPAPAGV---PTPMQMPNLQALPIQNIPGLGQVQIIHANQL---PPNLPANFQQVLTQLP 522
                ..||.:|:   .....:|.:|      .|  |.:|.|.:::|   ||..|..:...|:.:.
 Frog    70 LWSNDVPANSGIGSHAVTFGVPKVQ------YP--GHMQTIASHELPLTPPADPTAYSFDLSPVK 126

  Fly   523 MSHPQVQTQGQVQVMPKQEPQSPTQMITSIKQEPPDTFGPISATGNPPAPASTPNTASPQQQQIK 587
            :..||||:......   |:|.:..|..:...|                  .||..|    |:.:.
 Frog   127 VLAPQVQSNAAYHF---QDPSAVAQDFSGFMQ------------------GSTTLT----QRHLS 166

  Fly   588 FLHTESNSLSSLSIPASIQITALPQQATNTPNTPATTQPIPVSLPARSKVNAVTTSSTQITIAPT 652
            ..|.:..:..||             |.|:..|.|:.....|:.:.::.:..|:..||::..:..|
 Frog   167 STHIDEQTWWSL-------------QQTSPNNFPSFHLANPLVVGSQPQFAALLQSSSKTLLNST 218

  Fly   653 GGQVVSVTTQARGATASIRSTNTSTTTITTPSQSHLNMNISVASVGGAATGGGGGTATGEPKPRL 717
                                                                          .|.
 Frog   219 --------------------------------------------------------------RRC 221

  Fly   718 KRVACTCPNC--TDGEKHSDKKRQHICHITGCHKVYGKTSHLRAHLRWHTGERPFVCSWAFCGKR 780
            :|  |.||||  :...:...||:.||||:.||.|||||||||:||||||.|||||:|:|..|||.
 Frog   222 RR--CKCPNCQASPSNEEPGKKKLHICHLPGCGKVYGKTSHLKAHLRWHAGERPFICNWMLCGKS 284

  Fly   781 FTRSDELQRHRRTHTGEKRFQCQECNKKFMRSDHLSKHIKTH 822
            ||||||||||.|||||||||.||||.|:||||||||||.|||
 Frog   285 FTRSDELQRHLRTHTGEKRFGCQECGKRFMRSDHLSKHTKTH 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SppsNP_001262902.1 COG5048 <725..827 CDD:227381 73/100 (73%)
C2H2 Zn finger 742..764 CDD:275368 17/21 (81%)
zf-H2C2_2 756..783 CDD:290200 19/26 (73%)
C2H2 Zn finger 772..794 CDD:275368 16/21 (76%)
zf-H2C2_2 786..809 CDD:290200 19/22 (86%)
zf-C2H2 800..822 CDD:278523 17/21 (81%)
C2H2 Zn finger 802..822 CDD:275368 16/19 (84%)
sp5lXP_012811854.1 COG5048 <129..330 CDD:227381 101/300 (34%)
C2H2 Zn finger 249..268 CDD:275368 15/18 (83%)
C2H2 Zn finger 276..298 CDD:275368 16/21 (76%)
zf-H2C2_2 290..313 CDD:372612 19/22 (86%)
C2H2 Zn finger 306..326 CDD:275368 16/19 (84%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1085860at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.