DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twin and ANGEL2

DIOPT Version :9

Sequence 1:NP_732964.1 Gene:twin / 42880 FlyBaseID:FBgn0011725 Length:567 Species:Drosophila melanogaster
Sequence 2:NP_653168.2 Gene:ANGEL2 / 90806 HGNCID:30534 Length:544 Species:Homo sapiens


Alignment Length:463 Identity:109/463 - (23%)
Similarity:185/463 - (39%) Gaps:153/463 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   189 QRPWLPLAKPNKTR----------PAC-------IFTVMCYNVLCDKYA--TRQMYGYCPSWALC 234
            :|.|..:...:|.:          |.|       .|:||.||:|.....  ...:|.:|....|.
Human   132 KRNWEYICSHDKEKTKILGDKNVDPKCEDSENKFDFSVMSYNILSQDLLEDNSHLYRHCRRPVLH 196

  Fly   235 WEYRKKSIIDEIRHYAADIISLQEIETEQFYHFFLPELKNDGYEGIFSPKSRAKTMSELERKYVD 299
            |.:|..:|:.||:|:.||::.|||::.:.:.....|.|::.||...:..::..|.         |
Human   197 WSFRFPNILKEIKHFDADVLCLQEVQEDHYGAEIRPSLESLGYHCEYKMRTGRKP---------D 252

  Fly   300 GCAIFFRASKFTLIKESLIEFNQLAMANAEGSDNMLNRVMPKDNIGLAALLKVKENAWEPMSEVT 364
            ||||.|:.|||:|:..:.:||.:..::           ::.:||:||..||:.|         :.
Human   253 GCAICFKHSKFSLLSVNPVEFFRPDIS-----------LLDRDNVGLVLLLQPK---------IP 297

  Fly   365 QISQPLLVCTAHIH--WDPEFCDVKLIQTMMLSNELKTIIDEASHSFRPGHKNDSNAVQLLLCGD 427
            ..:.| .:|.|:.|  ::|...|:||.|..||..|:.::          .|:.|.:...:::|||
Human   298 YAACP-AICVANTHLLYNPRRGDIKLTQLAMLLAEISSV----------AHQKDGSFCPIVMCGD 351

  Fly   428 FNSLPDSGVVEFLGKGRVSMDHLDF-KDMGYK--SCLQRLLS----------------------- 466
            |||:|.|.:..|:.:|:::.:.|.. |..|.:  |..||:||                       
Human   352 FNSVPGSPLYSFIKEGKLNYEGLPIGKVSGQEQSSRGQRILSIPIWPPNLGISQNCVYEVQQVPK 416

  Fly   467 -----ND------------------TNEFTHSFKLASAYNEDIMPHTNYTFDFKGI--------- 499
                 :|                  ::...|.|.|:|.|        ::.|...||         
Human   417 VEKTDSDLTQTQLKQTEVLVTAEKLSSNLQHHFSLSSVY--------SHYFPDTGIPEVTTCHSR 473

  Fly   500 ----IDYIFYTKT----------------GMVPLGLLGPVSND--WLRENKVVGCPHPHIPSDHF 542
                :|||||:..                |:..|..|..::..  |    .|.|.|:.:..|||.
Human   474 SAITVDYIFYSAEKEDVAGHPGAEVALVGGLKLLARLSLLTEQDLW----TVNGLPNENNSSDHL 534

  Fly   543 PLLVELEL 550
            |||.:..|
Human   535 PLLAKFRL 542

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twinNP_732964.1 LRR_4 74..114 CDD:289563
LRR_8 75..130 CDD:290566
leucine-rich repeat 76..98 CDD:275378
LRR_4 97..136 CDD:289563
leucine-rich repeat 99..121 CDD:275378
leucine-rich repeat 122..144 CDD:275378
leucine-rich repeat 145..156 CDD:275378
Deadenylase_CCR4 209..550 CDD:197331 102/424 (24%)
ANGEL2NP_653168.2 EEP 169..542 CDD:321002 102/424 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5239
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D724242at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.