DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twin and AT3G58580

DIOPT Version :10

Sequence 1:NP_732964.1 Gene:twin / 42880 FlyBaseID:FBgn0011725 Length:567 Species:Drosophila melanogaster
Sequence 2:NP_191417.2 Gene:AT3G58580 / 825027 AraportID:AT3G58580 Length:603 Species:Arabidopsis thaliana


Alignment Length:115 Identity:27/115 - (23%)
Similarity:47/115 - (40%) Gaps:29/115 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 LGNGLLISTGHKWRQHRKLIAPTFHLNVLKSFIDLF---------NENSRLVVKKMQKENGKV-- 184
            |||..|:.:|..|||...|      ....|.:.||:         :||.|.|..::..::..|  
plant    22 LGNMALVKSGWLWRQSWVL------KRWKKHWFDLWLDGNLLYYPDENRRTVEDRIPMKSNCVNV 80

  Fly   185 ---FDCHDYM--------SECTVEILLETAMGVSKKTQDQSGYDYAMAVM 223
               .:|.|.:        |..|||:...:.:.:..::.|.: ..:.||:|
plant    81 RAGQECGDILPPDGSTQDSLVTVELRDRSKLLLCAESDDDA-VAWKMALM 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twinNP_732964.1 LRR <52..>155 CDD:443914 9/23 (39%)
leucine-rich repeat 76..98 CDD:275378
leucine-rich repeat 99..121 CDD:275378
leucine-rich repeat 122..144 CDD:275378 5/12 (42%)
leucine-rich repeat 145..156 CDD:275378 2/10 (20%)
Deadenylase_CCR4 209..550 CDD:197331 4/15 (27%)
AT3G58580NP_191417.2 PLN03144 1..602 CDD:178689 27/115 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.