DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twin and AT3G18500

DIOPT Version :9

Sequence 1:NP_732964.1 Gene:twin / 42880 FlyBaseID:FBgn0011725 Length:567 Species:Drosophila melanogaster
Sequence 2:NP_001189925.1 Gene:AT3G18500 / 821380 AraportID:AT3G18500 Length:449 Species:Arabidopsis thaliana


Alignment Length:482 Identity:119/482 - (24%)
Similarity:200/482 - (41%) Gaps:125/482 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 RVLPY--EIGKLFHLVILGLMGNPLQKEFMNIYNEPNGTQKLLTYMLDNLSFT---VNPPPQR-- 190
            |:||.  .:...||...|..:.  .:..|:...:..:|..........|.|::   .||.|:|  
plant    19 RILPSGGHLSSGFHQCPLSSLS--FRSSFVCCSSSTSGPSDSNPESSSNRSYSRRWQNPLPRRQH 81

  Fly   191 ----PWLPLAK---PNKTRPAC----IFTVMCYNVLCDKYAT--RQMYGYCPSWALCWEYRKKSI 242
                |...:|:   .:.|.|..    .|||:.||:|.|..::  |::|.......|.|.|||:.|
plant    82 PDQIPSSQIARDWIDSDTTPVSQALERFTVVSYNILGDGNSSYHRELYSNVSVPYLKWGYRKRLI 146

  Fly   243 IDEIRHYAADIISLQEIETEQFYHFFLPELKNDGYEGIFSPKSRAKTMSELERK---YVDGCAIF 304
            .:|:.....||||:||:               |.|..:||...:|......:|:   .|||||:|
plant   147 CEELIRLNPDIISMQEV---------------DKYFDLFSMMEKAGYAGSYKRRTGDNVDGCAMF 196

  Fly   305 FRASKFTLIKESLIEFNQLAMANAEGSDNMLNRVMPKDNIGLAALLKVKENAWEPMSEVTQISQP 369
            ::|.:|.:::...|||:|..|               :||:...|:|::::         :..|:.
plant   197 WKADRFGVLERENIEFSQFGM---------------RDNVAQLAVLELRK---------SNKSRK 237

  Fly   370 LLVCTAHIHWDPEFCDVKLIQTMMLSNELKTIIDEASHSFRPGHKNDSNAVQLLLCGDFNSLPDS 434
            :|:...|:.::|...||||.|...|.::...:      |.:.|.      :.::|||||||.|.|
plant   238 ILLGNIHVLYNPNQGDVKLGQVRSLCSKAHLL------SKKWGD------IPIVLCGDFNSTPKS 290

  Fly   435 GVVEFLGKGRVSMDHLDFKDM-GYKSCLQ----------------------------RLLSNDTN 470
            .:..||....:::...|.|:: |.|:|..                            |:.:...|
plant   291 PLYNFLASSELNVMEHDKKELSGQKNCRPTKVLETGSKSSNTITFRSFCSSWTKEEIRVATGQEN 355

  Fly   471 EF--THSFKLASAY-------------NEDIMPHTNYTFDFKGIIDYIFYTKTGMVPLGLLGPVS 520
            .:  .|..||.|:|             .|.:.  |:|...|.|.:||::|: .|::|..:|..:.
plant   356 SYWAAHPLKLNSSYASVKGSANTRDSVGEPLA--TSYHSKFLGTVDYLWYS-DGLLPARVLDTLP 417

  Fly   521 NDWLRENKVVGCPHPHIPSDHFPLLVE 547
            .|.|.:.|  |.|...:.|||..|:.|
plant   418 IDVLCKTK--GLPCQELGSDHLALVSE 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twinNP_732964.1 LRR_4 74..114 CDD:289563
LRR_8 75..130 CDD:290566
leucine-rich repeat 76..98 CDD:275378
LRR_4 97..136 CDD:289563 1/2 (50%)
leucine-rich repeat 99..121 CDD:275378
leucine-rich repeat 122..144 CDD:275378 3/12 (25%)
leucine-rich repeat 145..156 CDD:275378 1/10 (10%)
Deadenylase_CCR4 209..550 CDD:197331 99/388 (26%)
AT3G18500NP_001189925.1 EEP 111..445 CDD:294334 99/388 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5239
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.