DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twin and LRRC27

DIOPT Version :9

Sequence 1:NP_732964.1 Gene:twin / 42880 FlyBaseID:FBgn0011725 Length:567 Species:Drosophila melanogaster
Sequence 2:NP_001137229.1 Gene:LRRC27 / 80313 HGNCID:29346 Length:530 Species:Homo sapiens


Alignment Length:452 Identity:92/452 - (20%)
Similarity:156/452 - (34%) Gaps:152/452 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 ITGCVRNISPSL-------------WEFEHLTALYLNDNQLLRLPAD-VGMLTSLRTLDLSSNKL 109
            :.|.:.:.||.|             :....|..|:|..|.|..:|.| ..:|.:|..|||..|::
Human    39 VGGIIFSSSPILDLSESGLCRLEEVFRIPSLQQLHLQRNALCVIPQDFFQLLPNLTWLDLRYNRI 103

  Fly   110 RSLPAELGELIQLRELLLNNNFLRVLPYEIGKLFHLVILGLMGNPL--------QKEFMNIYNEP 166
            ::||:.:|....|:.|||..|.:::||.|:|.:..|..|.|...||        ||..:.|    
Human   104 KALPSGIGAHQHLKTLLLERNPIKMLPVELGSVTTLKALNLRHCPLEFPPQLVVQKGLVAI---- 164

  Fly   167 NGTQKLLTYMLDNLSFTVNP-----PPQR---------PWLPLAKPNKTRPACIFTVMCYNVLCD 217
               |:.|.......|...||     ||.|         |.|.|:..:.:....:........:..
Human   165 ---QRFLRMWAVEHSLPRNPTSQEAPPVREMTLRDLPSPGLELSGDHASNQGAVNAQDPEGAVMK 226

  Fly   218 KYAT-------------RQMYGYCPSW------ALCWEYRKKSIIDEIRHYAADIISLQ------ 257
            :.|:             |:......:|      ...|:.|:    :.:.|..||::..|      
Human   227 EKASFLPPVEKPDLSELRKSADSSENWPSEEEIRRFWKLRQ----EIVEHVKADVLGDQLLTREL 287

  Fly   258 ----------EIETEQFYHFF----------LPELKNDGYEGIFSPK----SRAKTMSELERKYV 298
                      |.|..:..|.|          ||:|.:. |:.....|    |||..:.||:.|. 
Human   288 PPNLKAALNIEKELPKPRHVFRRKTASSRSILPDLLSP-YQMAIRAKRLEESRAAALRELQEKQ- 350

  Fly   299 DGCAIF--------------FRASKFTLIKESLIEF-----NQLAMANAEGSDNMLNRVMPKDNI 344
               |:.              .||.:....||.|.:.     :.:|......:|.:.||.:|.:..
Human   351 ---ALMEQQRREKRALQEWRERAQRMRKRKEELSKLLPPRRSMVASKIPSATDLIDNRKVPLNPP 412

  Fly   345 G---------------LAALL------KVKENAWE-----------PMSEVTQISQPLLVCT 374
            |               ::||.      |:|::..:           |:.|:.:.::.|.:.|
Human   413 GKMKPSKEKSPQASKEMSALQERNLEEKIKQHVLQMREQRRFHGQAPLEEMRKAAEDLEIAT 474

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twinNP_732964.1 LRR_4 74..114 CDD:289563 14/40 (35%)
LRR_8 75..130 CDD:290566 20/55 (36%)
leucine-rich repeat 76..98 CDD:275378 8/22 (36%)
LRR_4 97..136 CDD:289563 13/38 (34%)
leucine-rich repeat 99..121 CDD:275378 8/21 (38%)
leucine-rich repeat 122..144 CDD:275378 9/21 (43%)
leucine-rich repeat 145..156 CDD:275378 5/18 (28%)
Deadenylase_CCR4 209..550 CDD:197331 44/266 (17%)
LRRC27NP_001137229.1 LRR 1 46..67 3/20 (15%)
leucine-rich repeat 49..68 CDD:275378 1/18 (6%)
LRR_8 67..126 CDD:290566 21/58 (36%)
LRR_4 67..108 CDD:289563 14/40 (35%)
LRR 2 68..89 7/20 (35%)
leucine-rich repeat 69..92 CDD:275378 8/22 (36%)
LRR_4 91..127 CDD:289563 13/35 (37%)
LRR 3 92..113 8/20 (40%)
leucine-rich repeat 93..115 CDD:275378 8/21 (38%)
LRR 4 115..136 9/20 (45%)
leucine-rich repeat 116..138 CDD:275378 9/21 (43%)
LRR 5 138..159 5/20 (25%)
leucine-rich repeat 139..150 CDD:275378 4/10 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 178..215 8/36 (22%)
DUF3629 <331..471 CDD:289102 25/143 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 402..432 4/29 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5239
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.