DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twin and pde12

DIOPT Version :9

Sequence 1:NP_732964.1 Gene:twin / 42880 FlyBaseID:FBgn0011725 Length:567 Species:Drosophila melanogaster
Sequence 2:NP_001038753.2 Gene:pde12 / 692319 ZFINID:ZDB-GENE-060519-25 Length:591 Species:Danio rerio


Alignment Length:373 Identity:105/373 - (28%)
Similarity:159/373 - (42%) Gaps:92/373 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   209 VMCYNVLCDKYATRQ-----MYGYCPSWALCWEYRKKSIIDEIRHYAADIISLQEIETEQFYHFF 268
            |:.||:|.|.||...     :|.||..:||..:||:..|..|:..|.||||.|||::...|....
Zfish   273 VVSYNILADVYAQTDLSKTVLYPYCAPYALQMDYRQNLIKKELSGYNADIICLQEVDKCVFVDLL 337

  Fly   269 LPELKNDGYEGIFSPKSRAKTMSELERKYVDGCAIFFRASKFTLIKESLIEFNQLAMANAEGSDN 333
            .|.|...|.:|:|          .::.|..:|.|.:||.||..|:               |..|.
Zfish   338 CPALDAFGLDGVF----------RIKEKQHEGLATYFRRSKLKLV---------------EQYDV 377

  Fly   334 MLNRVMPKDNIGLAALLKVKENAWEPMS----------------EVTQI------SQPLLVCTAH 376
            ||:..:..|        .:....||.:|                :||.:      |:.|.|...|
Zfish   378 MLSEALTTD--------PIHRQLWEKVSCSPSLKEKIEKRSTTLQVTVLQSLCDPSRILCVGNTH 434

  Fly   377 IHWDPEFCDVKLIQTMMLSNELKTIIDEASHSFRPGHKNDSNAVQLLLCGDFNSLPDSGVVEFLG 441
            ::|.||..:|:|:|..:....:|.::.|.    .||       .:|:..|||||.|.||:.:.|.
Zfish   435 LYWRPEGGNVRLVQIAVALEHMKQVVTEK----HPG-------ARLIFSGDFNSTPSSGLFQLLS 488

  Fly   442 KGRVSMDHLDFKDMGYKSCLQRLLSNDTNEFTHSFKLASAYNEDIMPHTNYTFDFKGIIDYIFYT 506
            :|.:..||.|:...|.:..::..|:|       .|:|:||..  :...||:...|:|.:||||..
Zfish   489 QGCIPEDHEDWGSGGPEEQIRLGLTN-------PFQLSSACG--VPDFTNFVGGFQGCLDYIFVE 544

  Fly   507 KTGM-----VPLGLLGPVSNDWLRENKVVGCPHPHIPSDHFPLLVELE 549
            ...:     :||..|..|||       .|..|....||||..|:.:|:
Zfish   545 PRTLQVEQVIPLPSLEEVSN-------CVALPSISHPSDHIALVCDLK 585

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twinNP_732964.1 LRR_4 74..114 CDD:289563
LRR_8 75..130 CDD:290566
leucine-rich repeat 76..98 CDD:275378
LRR_4 97..136 CDD:289563
leucine-rich repeat 99..121 CDD:275378
leucine-rich repeat 122..144 CDD:275378
leucine-rich repeat 145..156 CDD:275378
Deadenylase_CCR4 209..550 CDD:197331 105/373 (28%)
pde12NP_001038753.2 EEP 273..586 CDD:294334 105/373 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5239
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D724242at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.