DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twin and nocta

DIOPT Version :9

Sequence 1:NP_732964.1 Gene:twin / 42880 FlyBaseID:FBgn0011725 Length:567 Species:Drosophila melanogaster
Sequence 2:XP_700794.1 Gene:nocta / 572044 ZFINID:ZDB-GENE-050208-306 Length:432 Species:Danio rerio


Alignment Length:370 Identity:89/370 - (24%)
Similarity:154/370 - (41%) Gaps:86/370 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   209 VMCYNVLCDKYAT-RQMYGYCPSWALCWEYRKKSIIDEIRHYAADIISLQEIETEQFYHFFLPEL 272
            :|.:|:|...... :..:..||..||.|..||..|::||..|..|::.|||:  :.::..|.|.|
Zfish   135 IMQWNILAQALGEGKDGFVRCPMEALNWSERKYLILEEILTYRPDVVCLQEV--DHYFDTFQPVL 197

  Fly   273 KNDGYEGIFSPKSRAKTMSELERKYVDGCAIFFRASKFTLIKESLIEFNQLAMANAEGSDNMLNR 337
            .:.||:..|.||..:..:........||||:||...:|.::..:.:.               |:.
Zfish   198 SSLGYQSSFCPKPCSPCLDVHNNNGPDGCALFFNRRRFQMLHTAHLR---------------LSA 247

  Fly   338 VMPKDN-IGLAALLKVKENAWEPMSEVTQISQPLLVCTAHIH------WDPEFCDVKLIQTMMLS 395
            :|.|.| :.:.|.|:.|...             .:.|.|..|      |:       ..::...:
Zfish   248 MMLKTNQVAVVATLRCKLTG-------------RVFCVAVTHLKARSGWE-------AFRSAQGA 292

  Fly   396 NELKTIIDEASHSFRPGHKND-SNAVQLLLCGDFNSLPDSGVVEFLGKGRVSMDHLDFKDMGYKS 459
            |.|:.:.:..|.|....|::| :..:.|::|||||:.|:..|........:.:|.:      || 
Zfish   293 NLLQQLHEITSQSNPEMHQDDQTEGIPLIVCGDFNAEPNEEVYRHFRSSSLGLDSV------YK- 350

  Fly   460 CLQRLLSND-TNEFTHSFKLASAYNEDIMPHTNYTFDFKG----IIDYIFYTKTGMVPLGLLGPV 519
            |    ||:| |.|               .|:|::.....|    .:|||:|::.......:|...
Zfish   351 C----LSDDRTTE---------------PPYTSWKIRPSGECCSTLDYIWYSEKAFEVDAVLRIP 396

  Fly   520 SNDWLRENKVVGCPHPHIPSDHFPLLVELELMHTASQQAPPNGLI 564
            |.:.:..:::   |..|.||||..|:.:|..    |||  |:.|:
Zfish   397 SEEQIGPDRL---PSFHYPSDHLSLVCDLSF----SQQ--PHRLM 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twinNP_732964.1 LRR_4 74..114 CDD:289563
LRR_8 75..130 CDD:290566
leucine-rich repeat 76..98 CDD:275378
LRR_4 97..136 CDD:289563
leucine-rich repeat 99..121 CDD:275378
leucine-rich repeat 122..144 CDD:275378
leucine-rich repeat 145..156 CDD:275378
Deadenylase_CCR4 209..550 CDD:197331 84/354 (24%)
noctaXP_700794.1 Deadenylase_nocturnin 134..424 CDD:197330 84/354 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5239
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.