DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twin and angel2

DIOPT Version :9

Sequence 1:NP_732964.1 Gene:twin / 42880 FlyBaseID:FBgn0011725 Length:567 Species:Drosophila melanogaster
Sequence 2:NP_001025131.1 Gene:angel2 / 562704 ZFINID:ZDB-GENE-030131-6498 Length:569 Species:Danio rerio


Alignment Length:515 Identity:134/515 - (26%)
Similarity:201/515 - (39%) Gaps:146/515 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 VLPYEIGKLFHLVILGLMGN----PLQKEFMNIYNE----------PNGTQ--KLLTYMLDNLS- 181
            |||:..|  .|| ..|||.:    |.||...:...|          |.|::  |.....|.|:| 
Zfish    97 VLPHTRG--LHL-SAGLMESTDRPPPQKRRKSAEGEISQRSPQHSPPKGSRSPKGSPEWLRNVSS 158

  Fly   182 ------FTVNPPPQRPWLPLAKPNKTRPAC---------IFTVMCYNV-----LCDKYATRQMYG 226
                  .:..|..:|.|..|:...|..|:.         .|:||.||:     |||   ...:|.
Zfish   159 IEVANRTSAVPELKRHWEDLSHLCKAAPSVNRGKQKWPFDFSVMSYNILSQDLLCD---NTYLYR 220

  Fly   227 YCPSWALCWEYRKKSIIDEIRHYAADIISLQEIETEQFYHFFLPELKNDGYEGIFSPKSRAKTMS 291
            :|....|.|..|..:||.|:..|:|||:.|||::.:.:.....|.|::.||...|..::..|.  
Zfish   221 HCNPPVLDWRNRFPNIIKELEQYSADIMCLQEVQEDHYKQQIKPSLESLGYHCEFKRRTGLKP-- 283

  Fly   292 ELERKYVDGCAIFFRASKFTLIKESLIEFNQLAMANAEGSDNMLNRVMPKDNIGLAALLKVKENA 356
                   ||||:.|:..:|:|:....:|:.:..:.           :|.:||:||..||:     
Zfish   284 -------DGCAVIFKRERFSLVSCHPVEYFRRGVP-----------LMDRDNVGLIVLLR----- 325

  Fly   357 WEPMSEVTQISQPLLVCTAHIH--WDPEFCDVKLIQTMMLSNELKTIIDEASHSFRPGHKNDSNA 419
              |:.....:|.   :|.|:.|  ::|...|:||.|..||..|:.          |.....||:.
Zfish   326 --PIDPHVSLSN---ICVANTHLLYNPRRGDIKLAQLAMLLAEIS----------RVSQLPDSSV 375

  Fly   420 VQLLLCGDFNSLPDSGVVEFLGKGRVSMDHL---------------------------------D 451
            ..:||||||||:|.|.:..|:...|:..|.:                                 .
Zfish   376 CPVLLCGDFNSVPWSPLYRFIKDRRLDYDGMPIGKVSGQEETPRGQRILTVPIWPRSLGISQQCQ 440

  Fly   452 FKDMGYKSCLQRLLSNDTNEFT-----HSFKLASAYN----EDIMPHTNYTFDFKGI-IDYIFYT 506
            :::....|.|:.|...:...||     |..:|.|||:    |...|..........| :|||||:
Zfish   441 YENQTRDSELRDLEQTERESFTEASIEHCLRLTSAYSHHLKESGQPEITTCHSRTAITVDYIFYS 505

  Fly   507 ----------------KTGMVPLGLLGPVSNDWLRENKVVGCPHPHIPSDHFPLLVELEL 550
                            :.|:..||.|..|....|:  ||.|.|:.|..|||.|||....|
Zfish   506 AALGDVMAQAEYSAPPERGLQLLGRLALVGEKELQ--KVNGLPNQHNSSDHLPLLTRFRL 563

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twinNP_732964.1 LRR_4 74..114 CDD:289563
LRR_8 75..130 CDD:290566
leucine-rich repeat 76..98 CDD:275378
LRR_4 97..136 CDD:289563 1/1 (100%)
leucine-rich repeat 99..121 CDD:275378
leucine-rich repeat 122..144 CDD:275378 4/9 (44%)
leucine-rich repeat 145..156 CDD:275378 5/14 (36%)
Deadenylase_CCR4 209..550 CDD:197331 107/406 (26%)
angel2NP_001025131.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 63..92
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 109..155 11/45 (24%)
EEP 201..563 CDD:294334 107/406 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5239
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D724242at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.