DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twin and Angel2

DIOPT Version :9

Sequence 1:NP_732964.1 Gene:twin / 42880 FlyBaseID:FBgn0011725 Length:567 Species:Drosophila melanogaster
Sequence 2:NP_067396.3 Gene:Angel2 / 52477 MGIID:1196310 Length:544 Species:Mus musculus


Alignment Length:420 Identity:110/420 - (26%)
Similarity:176/420 - (41%) Gaps:120/420 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   207 FTVMCYNVLCDKYA--TRQMYGYCPSWALCWEYRKKSIIDEIRHYAADIISLQEIETEQFYHFFL 269
            |:||.||:|.....  ...:|.:|....|.|.:|..:|:.||:|:.||::.|||::.:.:.....
Mouse   167 FSVMSYNILSQDLLEDNSHLYRHCRRPVLHWSFRFPNILKEIKHFDADVLCLQEVQEDHYGTEIR 231

  Fly   270 PELKNDGYEGIFSPKSRAKTMSELERKYVDGCAIFFRASKFTLIKESLIEFNQLAMANAEGSDNM 334
            |.|::.||...:..|:..|.         |||||.|:.|:|:|:..:.:||              
Mouse   232 PSLESLGYHCEYKMKTGRKP---------DGCAICFKHSRFSLLSVNPVEF-------------- 273

  Fly   335 LNRVMP---KDNIGLAALLKVKENAWEPMSEVTQISQP-LLVCTAHIHWDPEFCDVKLIQTMMLS 395
            ..|.:|   :|||||..||:.|         :.:.:.| :.:...|:.::|...|:||.|..||.
Mouse   274 CRRDIPLLDRDNIGLVLLLQPK---------IPRAASPSICIANTHLLYNPRRGDIKLTQLAMLL 329

  Fly   396 NELKTIIDEASHSFRPGHKNDSNAVQLLLCGDFNSLPDSGVVEFLGKGRVSMDHLDF-KDMGYK- 458
            .|:..:.          |:.|.::..:::||||||:|.|.:..|:.:|:::.:.|.. |..|.: 
Mouse   330 AEIANVT----------HRKDGSSCPIVMCGDFNSVPGSPLYSFIKEGKLNYEGLAIGKVSGQEQ 384

  Fly   459 -SCLQRLLS----------------------------ND------------------TNEFTHSF 476
             |..||:||                            :|                  ::...|.|
Mouse   385 SSRGQRILSIPIWPPNLGISQNCVYEAQQVPKVEKTDSDVTQAQQEKAEVPVSADKVSSHLQHGF 449

  Fly   477 KLASAYNEDI----MPHTNYTFDFKGI-IDYIFYT----KTGMVP---------LGLLGPVSNDW 523
            .|:|.|:..:    :|..........| :||||||    .|...|         |.||..:|  .
Mouse   450 SLSSVYSHYVPDTGVPEVTTCHSRSAITVDYIFYTAKKENTAQGPGAEVALVGGLKLLARLS--L 512

  Fly   524 LREN---KVVGCPHPHIPSDHFPLLVELEL 550
            |.|.   .|.|.|:.|..|||.|||.:..|
Mouse   513 LTEQDLWTVNGLPNEHNSSDHLPLLAKFRL 542

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twinNP_732964.1 LRR_4 74..114 CDD:289563
LRR_8 75..130 CDD:290566
leucine-rich repeat 76..98 CDD:275378
LRR_4 97..136 CDD:289563
leucine-rich repeat 99..121 CDD:275378
leucine-rich repeat 122..144 CDD:275378
leucine-rich repeat 145..156 CDD:275378
Deadenylase_CCR4 209..550 CDD:197331 108/416 (26%)
Angel2NP_067396.3 EEP 169..542 CDD:294334 108/416 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5239
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.