DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twin and cu

DIOPT Version :9

Sequence 1:NP_732964.1 Gene:twin / 42880 FlyBaseID:FBgn0011725 Length:567 Species:Drosophila melanogaster
Sequence 2:NP_001097746.1 Gene:cu / 41339 FlyBaseID:FBgn0261808 Length:642 Species:Drosophila melanogaster


Alignment Length:350 Identity:88/350 - (25%)
Similarity:140/350 - (40%) Gaps:81/350 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   228 CPSWALCWEYRKKSIIDEIRHYAADIISLQEIETEQFYHFFLPELKNDGYEGIFSPKSRAKTMSE 292
            ||..||.||:||..|:.||.....|:|.|||::   .:.|....|.:..|.|||.||..:..:..
  Fly   333 CPEEALTWEHRKYLIVQEILQNQPDVICLQEVD---HFKFLQTVLGSQNYAGIFFPKPDSPCLYI 394

  Fly   293 LERKYVDGCAIFFRASKFTLIKESLIEFNQLAMANAEGSDNMLNRV--MPKDNIGLAALLKVKEN 355
            .:....||||||::..|..|                :|.|..:..|  :..:.:.:||.|:::.:
  Fly   395 EQNNGPDGCAIFYKRDKLQL----------------QGYDTRILEVWRVQSNQVAIAARLRMRSS 443

  Fly   356 AWEPMSEVTQISQPLLVCTAHIHWDPEFCDVKLIQTMMLSNELKTIIDEASHSFRPGHKNDSNAV 420
            ..|             .|.|..|       :|.....:|:.    :.:|.........|..:...
  Fly   444 GRE-------------FCVATTH-------LKARHGALLAK----LRNEQGRDLIRFVKQFAGDT 484

  Fly   421 QLLLCGDFNSLPDSGV------VEFLGKGRVSMD-HLDFKDMGYKSCLQRLLSNDTNEFTHSFKL 478
            .||||||||:.|...:      .:.|..|....| .||.:::.:.:.       |..||     :
  Fly   485 PLLLCGDFNAEPVEPIYATILGCDLLRLGSAYADVKLDREEILHPNA-------DVGEF-----V 537

  Fly   479 ASAYNEDIMPHTNYTFDFKG----IIDYIFYTKTGMVPLGLLGPVSNDWLRENKVVGCPHPHIPS 539
            |.:...: .|:|.:....:|    .|||:|||...:.....|...:.:.:.:|:.   |....||
  Fly   538 AKSMKRE-PPYTTWKIREEGEECHTIDYVFYTPDRLKIKNCLDFPAGEQIGKNRT---PSFQYPS 598

  Fly   540 DHFPLLVELELMHTASQQAPP--NG 562
            |||.|:.:.||:       ||  ||
  Fly   599 DHFSLVCDFELL-------PPTENG 616

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twinNP_732964.1 LRR_4 74..114 CDD:289563
LRR_8 75..130 CDD:290566
leucine-rich repeat 76..98 CDD:275378
LRR_4 97..136 CDD:289563
leucine-rich repeat 99..121 CDD:275378
leucine-rich repeat 122..144 CDD:275378
leucine-rich repeat 145..156 CDD:275378
Deadenylase_CCR4 209..550 CDD:197331 82/334 (25%)
cuNP_001097746.1 EEP 312..609 CDD:382041 82/334 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443966
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5239
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D724242at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12121
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.