DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twin and Pde12

DIOPT Version :9

Sequence 1:NP_732964.1 Gene:twin / 42880 FlyBaseID:FBgn0011725 Length:567 Species:Drosophila melanogaster
Sequence 2:NP_001014020.2 Gene:Pde12 / 306231 RGDID:1310975 Length:705 Species:Rattus norvegicus


Alignment Length:319 Identity:100/319 - (31%)
Similarity:144/319 - (45%) Gaps:59/319 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   201 TRPACIFTVMCYNVLCDKYATRQ-----MYGYCPSWALCWEYRKKSIIDEIRHYAADIISLQEIE 260
            |..:.|.|| .||:|.|.||..:     :|.||..:||..:||:..|..|:..|.||:|.|||::
  Rat   256 TEDSFIRTV-SYNILADTYAQTEFSRTVLYPYCAPYALELDYRQNLIQKELTGYNADLICLQEVD 319

  Fly   261 TEQFYHFFLPELKNDGYEGIFSPKSRAKTMSELERKYVDGCAIFFRASKFTLIKESLIEFNQLAM 325
            ...|....:|.|:..|.||:|..|..            :|.|.|:|.|||.|:.:..|.|.:   
  Rat   320 RAVFSDSLVPALEAFGLEGVFRIKQH------------EGLATFYRKSKFRLLSQHDISFQE--- 369

  Fly   326 ANAEGSDNMLNRVMPKDNIGLAALLKVKENAWEPMSEVTQI---------SQPLLVCTAHIHWDP 381
              |..||.:...::.|..:...|..||.:.     |.|.||         |:.:.|...|::|.|
  Rat   370 --ALKSDPLHKELLEKLALNPLAQEKVLQR-----SSVLQISVLQSTTDSSKKICVANTHLYWHP 427

  Fly   382 EFCDVKLIQTMMLSNELKTIIDEASHSFRPGHKNDSNAVQLLLCGDFNSLPDSGVVEFLGKGRVS 446
            :...::|||.......::.:    |....||       :.::.||||||.|.:|:..|:..|.|.
  Rat   428 KGGYIRLIQMAAALVHIRHV----SCDLYPG-------IPVIFCGDFNSTPSTGMYHFVINGSVP 481

  Fly   447 MDHLDFKDMGYKS-CLQRLLSNDTNEFTHSFKLASAYNEDIMPHTNYTFDFKGIIDYIF 504
            .||.|:...|.:. |...|        ||.|||.||..|.  .:|||...|.|.:||||
  Rat   482 EDHEDWASNGEEERCGMSL--------THCFKLKSACGEP--AYTNYVGGFHGCLDYIF 530

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twinNP_732964.1 LRR_4 74..114 CDD:289563
LRR_8 75..130 CDD:290566
leucine-rich repeat 76..98 CDD:275378
LRR_4 97..136 CDD:289563
leucine-rich repeat 99..121 CDD:275378
leucine-rich repeat 122..144 CDD:275378
leucine-rich repeat 145..156 CDD:275378
Deadenylase_CCR4 209..550 CDD:197331 97/311 (31%)
Pde12NP_001014020.2 EEP 265..539 CDD:294334 96/309 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D724242at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.