DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twin and Angel2

DIOPT Version :9

Sequence 1:NP_732964.1 Gene:twin / 42880 FlyBaseID:FBgn0011725 Length:567 Species:Drosophila melanogaster
Sequence 2:XP_038946747.1 Gene:Angel2 / 305035 RGDID:1305056 Length:544 Species:Rattus norvegicus


Alignment Length:457 Identity:114/457 - (24%)
Similarity:184/457 - (40%) Gaps:141/457 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   189 QRPWLPLAKPNKTRPACI-----------------FTVMCYNVLCDKYA--TRQMYGYCPSWALC 234
            :|.|..|...||.:...:                 |:||.||:|..:..  ...:|.:|....|.
  Rat   132 KRSWEYLCSHNKEKTKDLEDRNGDSTCEDCEDKFDFSVMSYNILSQELLEDNSHLYRHCRRPVLH 196

  Fly   235 WEYRKKSIIDEIRHYAADIISLQEIETEQFYHFFLPELKNDGYEGIFSPKSRAKTMSELERKYVD 299
            |.:|..:|:.||:|:.||::.|||::.:.:.....|.|::.||...:..|:..|.         |
  Rat   197 WSFRFPNILKEIKHFDADVLCLQEVQEDHYGTEIRPSLESLGYHCEYKMKTGRKP---------D 252

  Fly   300 GCAIFFRASKFTLIKESLIEFNQLAMANAEGSDNMLNRVMP---KDNIGLAALLKVKENAWEPMS 361
            ||||.|:.|||:|:..:.:||              ..|.:|   :|||||..||:.|        
  Rat   253 GCAICFKHSKFSLLSVNPVEF--------------CRRDIPLLDRDNIGLVLLLQPK-------- 295

  Fly   362 EVTQISQP-LLVCTAHIHWDPEFCDVKLIQTMMLSNELKTIIDEASHSFRPGHKNDSNAVQLLLC 425
             :.:.:.| :.:...|:.::|...|:||.|..||..|:..:          .|:.|.:...:::|
  Rat   296 -IPRAASPSICIANTHLLYNPRRGDIKLTQLAMLLAEISNV----------AHQKDGSFCPIVMC 349

  Fly   426 GDFNSLPDSGVVEFLGKGRVSMDHLDF-KDMGYK--SCLQRLLS--------------------- 466
            |||||:|.|.:..|:.:|:::.:.|.. |..|.:  |..||:||                     
  Rat   350 GDFNSVPGSPLYSFIKEGKLNYEGLAIGKVSGQEQSSRGQRILSIPIWPPNLGISQNCVYEAQQV 414

  Fly   467 -------ND------------------TNEFTHSFKLASAYNEDI----MPHTNYTFDFKGI-ID 501
                   :|                  ::...|.|.|:|.|:..:    :|..........| :|
  Rat   415 PKVEKTDSDVTQAQQEKAEVPVPADKVSSHLQHGFSLSSVYSHYVPDTGVPEVTTCHSRSAITVD 479

  Fly   502 YIFYT----KTGMVP---------LGLLGPVS-----NDWLRENKVVGCPHPHIPSDHFPLLVEL 548
            ||||:    .|...|         |.||..:|     :.|    .|.|.|:.|..|||.|||.:.
  Rat   480 YIFYSAEKDDTARGPGAEVALVGGLKLLARLSLLTEQDLW----TVNGLPNEHNSSDHLPLLAKF 540

  Fly   549 EL 550
            .|
  Rat   541 RL 542

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twinNP_732964.1 LRR_4 74..114 CDD:289563
LRR_8 75..130 CDD:290566
leucine-rich repeat 76..98 CDD:275378
LRR_4 97..136 CDD:289563
leucine-rich repeat 99..121 CDD:275378
leucine-rich repeat 122..144 CDD:275378
leucine-rich repeat 145..156 CDD:275378
Deadenylase_CCR4 209..550 CDD:197331 107/418 (26%)
Angel2XP_038946747.1 EEP 169..542 CDD:412407 107/418 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5239
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D724242at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.