DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twin and ANGEL1

DIOPT Version :9

Sequence 1:NP_732964.1 Gene:twin / 42880 FlyBaseID:FBgn0011725 Length:567 Species:Drosophila melanogaster
Sequence 2:NP_001357675.1 Gene:ANGEL1 / 23357 HGNCID:19961 Length:744 Species:Homo sapiens


Alignment Length:406 Identity:103/406 - (25%)
Similarity:169/406 - (41%) Gaps:102/406 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 QLRELLLNNNFLRVLPYEIGKLFHLVILGLMGN-----PLQKE---------------------- 158
            ||.:|....|.....|..:|:...|.:.|:.|:     |:|.|                      
Human   113 QLSDLRAAENLDEPFPEMLGEEPLLEVEGVEGSMWAAIPMQSEPQYADCAALPVGALATEQWEED 177

  Fly   159 ----FMNIYNEPNGTQKLLTYMLDNLSFTVNPPP---------QRPW-----LPLAKPNKT--RP 203
                ..:|..||...::...:..:.|. .:.||.         .|.|     .|.|:..|.  .|
Human   178 PAVLAWSIAPEPVPQEEASIWPFEGLG-QLQPPAVEIPYHEILWREWEDFSTQPDAQGLKAGDGP 241

  Fly   204 ACIFTVMCYNVLCD--KYATRQMYGYCPSWALCWEYRKKSIIDEIRHYAADIISLQEIETEQFYH 266
            ...||:|.||:|..  ...:.::|.:|....|.|.||..:::.|.:|:..||:.|||::.:.::.
Human   242 QFQFTLMSYNILAQDLMQQSSELYLHCHPDILNWNYRFVNLMQEFQHWDPDILCLQEVQEDHYWE 306

  Fly   267 FFLPELKNDGYEGIFSPKSRAKTMSELERKYVDGCAIFFRASKFTLIKESLIEFNQLAMANAEGS 331
            ...|.|:..|:...:..::..||         ||||:.::.::|.|:..|.:|:.:..:      
Human   307 QLEPSLRMMGFTCFYKRRTGCKT---------DGCAVCYKPTRFRLLCASPVEYFRPGL------ 356

  Fly   332 DNMLNRVMPKDNIGLAALLKVKENAWEPM--SEVTQIS-QPLLVCTAHIHWDPEFCDVKLIQTMM 393
             .:|||    ||:||..||       :|:  ..:.|:| .||.|...||.::|...||||.|..:
Human   357 -ELLNR----DNVGLVLLL-------QPLVPEGLGQVSVAPLCVANTHILYNPRRGDVKLAQMAI 409

  Fly   394 LSNELKTI--IDEASHSFRPGHKNDSNAVQLLLCGDFNSLPDSGVVEFLGKGRVSMDHLDFKDM- 455
            |..|:..:  :.:.||            ..::||||.||:|||.:..|:..|     .|.:..| 
Human   410 LLAEVDKVARLSDGSH------------CPIILCGDLNSVPDSPLYNFIRDG-----ELQYHGMP 457

  Fly   456 GYKS--CLQRLLSNDT 469
            .:||  .|.||..|.|
Human   458 AWKSLALLPRLECNGT 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twinNP_732964.1 LRR_4 74..114 CDD:289563
LRR_8 75..130 CDD:290566 3/8 (38%)
leucine-rich repeat 76..98 CDD:275378
LRR_4 97..136 CDD:289563 4/14 (29%)
leucine-rich repeat 99..121 CDD:275378 103/406 (25%)
leucine-rich repeat 122..144 CDD:275378 5/21 (24%)
leucine-rich repeat 145..156 CDD:275378 4/15 (27%)
Deadenylase_CCR4 209..550 CDD:197331 77/271 (28%)
ANGEL1NP_001357675.1 EEP 248..>449 CDD:351117 67/239 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143751
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5239
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.