DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6204 and Ct55

DIOPT Version :9

Sequence 1:NP_651229.2 Gene:CG6204 / 42877 FlyBaseID:FBgn0039165 Length:903 Species:Drosophila melanogaster
Sequence 2:NP_083418.1 Gene:Ct55 / 75013 MGIID:1922263 Length:236 Species:Mus musculus


Alignment Length:239 Identity:48/239 - (20%)
Similarity:78/239 - (32%) Gaps:83/239 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   634 LFRLLQSKCVLFEEAAEIQEAHIVACLTPHTEHVILVGDHKQLQPFSGSRKVPQISLFERLIVAG 698
            :.||:......|:..|:.:||        ..|...|:.|...||...|             :|||
Mouse     1 MHRLISRLRAFFQRKADPKEA--------KEERQKLLEDATSLQNKQG-------------VVAG 44

  Fly   699 LPFSRLNLQYRMRSCISELLVPSIYDELLC-------SESVKEYEDIRLMSKNLYFVQHNQPEHC 756
                         ||       |.||   |       |..|:..::......||......|....
Mouse    45 -------------SC-------SNYD---CMTKHTRSSADVETGDNPLKAEPNLPAAVEEQSPRG 86

  Fly   757 MSDMSIGNLYEAG--------VLAKLTEFLIQKAQYK-HS-----DIVI--LSPYNGQIECIKNA 805
            ::.:::.|.::..        :||.:|. |:..|.|. |.     ||..  ..||||.:..|:.:
Mouse    87 LNAVTVDNDHDEEPSESHMRILLASITS-LVGDADYNGHGFSFSLDIACKDFKPYNGDLVEIEFS 150

  Fly   806 LPQNYRS---------------TVQVASVDSFQGLEANIVLLSL 834
            ..|:.:|               .|:|...|...|:..:.:..:|
Mouse   151 DEQDTQSRRAILVKPLKHCHLNEVRVTRTDGSTGVLEDTIFFTL 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6204NP_651229.2 AAA_11 449..679 CDD:289831 11/44 (25%)
AAA_19 467..>513 CDD:289986
UvrD_C_2 688..869 CDD:304668 36/185 (19%)
Ct55NP_083418.1 S1-like 176..228 CDD:291136 4/19 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1112
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.