DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5515 and GIR2

DIOPT Version :9

Sequence 1:NP_001262901.1 Gene:CG5515 / 42875 FlyBaseID:FBgn0039163 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_010436.3 Gene:GIR2 / 851730 SGDID:S000002559 Length:265 Species:Saccharomyces cerevisiae


Alignment Length:233 Identity:64/233 - (27%)
Similarity:107/233 - (45%) Gaps:51/233 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 NYKEDQTNEVEALDSIYCGDMEILATE-PHHKFQIPIATEEYSSEEPE---KGLACKLVFTFTAT 64
            :|||:|..|:|.|:|||..::.|:..| |..||::.|..|..:.:...   |.......|.....
Yeast     2 DYKEEQKQELEVLESIYPDELRIINDEYPKIKFEVAIKLELDTGDSTSVLTKEHTIIAEFKLPEN 66

  Fly    65 YPDGAPVVEIE---------EPENFEDMFETRLLEHLQKTIE--EN------------------- 99
            |||...::.:|         |.:|.||..|....:|..|.::  ||                   
Yeast    67 YPDEPCLISLEAQEVALNDNEEDNEEDEDEVEYDDHGNKVLKKFENLPDLISFKGYLPELTVQLE 131

  Fly   100 --------LGMEMIFSLVSSAQEWLNERWDEHKFHQEELREQKLREIEEEERKKFEGTRVTVESF 156
                    |||:|.|:|:||.:|...:.:.|.....|:..|.:.:|.|::|:.||.||:||.||:
Yeast   132 SQIETDMLLGMQMCFALISSIKERCEQWYSEQLNKLEKQYELEAQEREKKEQAKFHGTKVTRESY 196

  Fly   157 LKWKLEFEESTGIAAKREKNNVSK------KQTGRELF 188
            |:|:.:|.:...:   .|::.|.:      |.||:::|
Yeast   197 LEWRSKFRQELKL---DERDQVRRMKAHHGKLTGKQMF 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5515NP_001262901.1 RWD 4..116 CDD:283440 41/153 (27%)
DFRP_C 149..>198 CDD:293151 14/46 (30%)
GIR2NP_010436.3 RWD 5..154 CDD:399058 38/148 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157346830
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4018
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I1649
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55238
OrthoFinder 1 1.000 - - FOG0003763
OrthoInspector 1 1.000 - - oto99295
orthoMCL 1 0.900 - - OOG6_102929
Panther 1 1.100 - - LDO PTHR12292
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1746
SonicParanoid 1 1.000 - - X3127
TreeFam 1 0.960 - -
1312.790

Return to query results.
Submit another query.