DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5515 and Rwdd1

DIOPT Version :9

Sequence 1:NP_001262901.1 Gene:CG5515 / 42875 FlyBaseID:FBgn0039163 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_079890.1 Gene:Rwdd1 / 66521 MGIID:1913771 Length:243 Species:Mus musculus


Alignment Length:248 Identity:106/248 - (42%)
Similarity:156/248 - (62%) Gaps:15/248 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 NYKEDQTNEVEALDSIYCGDMEILATEPHHKFQIPIATEEYSSEEPEKGLACKLVFTFTATYPDG 68
            :|.|:|.||:|||:|||.....:|:..| ..|.|.:.:|   :.|.::.:...|.||::..|||.
Mouse     3 DYGEEQRNELEALESIYPDSFTVLSESP-PSFTITVTSE---AGENDETVQTTLKFTYSEKYPDE 63

  Fly    69 APVVEIEEPENFEDMFETRLLEHLQKTIEENLGMEMIFSLVSSAQEWLNERWDEHKFHQEELREQ 133
            .|:.||...||.||...:.:|:.|....||||||.|||:||::.||.|||..|:.|..:||.::|
Mouse    64 TPLYEIFSQENLEDNDVSDILKLLALQAEENLGMVMIFTLVTAVQEKLNEIVDQIKTRREEEKKQ 128

  Fly   134 KLREIEEEERKKFEGTRVTVESFLKWKLEFE-ESTGIAAKR--EKNNVSK-KQTGRELFMCDNTL 194
            |.:|.||.|:|.|.||.||:|:||.||.:|: |...|..||  |:....| |.:|::||..|:.|
Mouse   129 KEKEAEEAEKKLFHGTPVTIENFLSWKAKFDAELLEIKKKRMKEEEQAGKNKLSGKQLFETDHNL 193

  Fly   195 NDSDIKFLLEAGENIENVKIDETLFQDIGELDLDD-DDDEDW---VPGADDDD 243
            :.|||:||.:||.|:|   :||:|||::.:|:|:| :||.|:   .||:|..|
Mouse   194 DTSDIQFLEDAGNNVE---VDESLFQEMDDLELEDGEDDPDYNPVAPGSDSSD 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5515NP_001262901.1 RWD 4..116 CDD:283440 45/111 (41%)
DFRP_C 149..>198 CDD:293151 21/52 (40%)
Rwdd1NP_079890.1 RWD 6..111 CDD:310403 44/108 (41%)
Interaction with DRG2. /evidence=ECO:0000269|PubMed:15676025 142..197 22/54 (41%)
DFRP_C <144..>197 CDD:330458 21/52 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 208..243 15/37 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167850857
Domainoid 1 1.000 74 1.000 Domainoid score I9146
eggNOG 1 0.900 - - E1_KOG4018
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41082
Inparanoid 1 1.050 172 1.000 Inparanoid score I4089
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55238
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003763
OrthoInspector 1 1.000 - - oto92778
orthoMCL 1 0.900 - - OOG6_102929
Panther 1 1.100 - - LDO PTHR12292
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1746
SonicParanoid 1 1.000 - - X3127
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.