DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5515 and RWDD1

DIOPT Version :9

Sequence 1:NP_001262901.1 Gene:CG5515 / 42875 FlyBaseID:FBgn0039163 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_057036.2 Gene:RWDD1 / 51389 HGNCID:20993 Length:243 Species:Homo sapiens


Alignment Length:246 Identity:107/246 - (43%)
Similarity:157/246 - (63%) Gaps:13/246 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 NYKEDQTNEVEALDSIYCGDMEILATEPHHKFQIPIATEEYSSEEPEKGLACKLVFTFTATYPDG 68
            :|.|:|.||:|||:|||.....:|:..| ..|.|.:.:|   :.|.::.:...|.||::..|||.
Human     3 DYGEEQRNELEALESIYPDSFTVLSENP-PSFTITVTSE---AGENDETVQTTLKFTYSEKYPDE 63

  Fly    69 APVVEIEEPENFEDMFETRLLEHLQKTIEENLGMEMIFSLVSSAQEWLNERWDEHKFHQEELREQ 133
            ||:.||...||.||...:.:|:.|....||||||.|||:||::.||.|||..|:.|..:||.::|
Human    64 APLYEIFSQENLEDNDVSDILKLLALQAEENLGMVMIFTLVTAVQEKLNEIVDQIKTRREEEKKQ 128

  Fly   134 KLREIEEEERKKFEGTRVTVESFLKWKLEFE-ESTGIAAKR--EKNNVSK-KQTGRELFMCDNTL 194
            |.:|.||.|::.|.||.||:|:||.||.:|: |...|..||  |:....| |.:|::||..|:.|
Human   129 KEKEAEEAEKQLFHGTPVTIENFLNWKAKFDAELLEIKKKRMKEEEQAGKNKLSGKQLFETDHNL 193

  Fly   195 NDSDIKFLLEAGENIENVKIDETLFQDIGELDL-DDDDDEDWVPGADDDDD 244
            :.|||:||.:||.|:|   :||:|||::.:|:| ||:||.|:.| ||.:.|
Human   194 DTSDIQFLEDAGNNVE---VDESLFQEMDDLELEDDEDDPDYNP-ADPESD 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5515NP_001262901.1 RWD 4..116 CDD:283440 46/111 (41%)
DFRP_C 149..>198 CDD:293151 21/52 (40%)
RWDD1NP_057036.2 RWD 6..111 CDD:368608 45/108 (42%)
Interaction with DRG2. /evidence=ECO:0000250 142..197 22/54 (41%)
DFRP_C <144..217 CDD:374615 34/75 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 198..243 23/47 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165160510
Domainoid 1 1.000 76 1.000 Domainoid score I9004
eggNOG 1 0.900 - - E1_KOG4018
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41082
Inparanoid 1 1.050 173 1.000 Inparanoid score I4088
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55238
OrthoDB 1 1.010 - - D1269244at2759
OrthoFinder 1 1.000 - - FOG0003763
OrthoInspector 1 1.000 - - oto89211
orthoMCL 1 0.900 - - OOG6_102929
Panther 1 1.100 - - LDO PTHR12292
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1746
SonicParanoid 1 1.000 - - X3127
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.