DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5515 and rwdd

DIOPT Version :9

Sequence 1:NP_001262901.1 Gene:CG5515 / 42875 FlyBaseID:FBgn0039163 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_001307019.1 Gene:rwdd / 449812 ZFINID:ZDB-GENE-041010-61 Length:187 Species:Danio rerio


Alignment Length:233 Identity:55/233 - (23%)
Similarity:91/233 - (39%) Gaps:48/233 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSRNYKEDQTNEVEALDSIYCGDMEILATEPHHKFQIPIATEEYSSEEPEKGLACKLVFTFTATY 65
            |:.|  |||..|:|||.|||.||.......| ..||..:...:.|.       :..|..::...|
Zfish     1 MTAN--EDQEMELEALRSIYEGDDCFKELSP-VSFQFRVGDLDDSK-------SFLLEVSWPENY 55

  Fly    66 PDGAPVVEIEEPENFEDMFETR--LLEHLQKTIEENLGMEMIFSLVSSAQEWLNERWDEHKFHQE 128
            |:.||.:.::...|.....:|:  :|..:.:.:|.|||..|:::|.    ||             
Zfish    56 PESAPCISLDTFFNNRLSAQTKQYILSKMSEQVEANLGTAMMYTLF----EW------------- 103

  Fly   129 ELREQKLREIEEEERKKFEGTRVTVESFLKWKLEFEESTGIAAKREKNNVSKKQTGRELFMCDNT 193
             .:|.|...:|..:......|.::....:      ..||.::.|:||.....|...|:|      
Zfish   104 -AKESKETLMENHQPVTSAVTLISSSDVM------NNSTSVSKKKEKKEQLTKAQKRKL------ 155

  Fly   194 LNDSDIKFLLEAGENIENVKIDETLFQDIGELDLDDDD 231
            :..:|.|..|..|.|..:|      .:.:.:....|||
Zfish   156 IGRTDNKGELPRGWNWVDV------IKHLSKTGGKDDD 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5515NP_001262901.1 RWD 4..116 CDD:283440 32/113 (28%)
DFRP_C 149..>198 CDD:293151 9/48 (19%)
rwddNP_001307019.1 RWD 4..106 CDD:283440 33/129 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.