DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5515 and CG10343

DIOPT Version :9

Sequence 1:NP_001262901.1 Gene:CG5515 / 42875 FlyBaseID:FBgn0039163 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_609900.1 Gene:CG10343 / 35127 FlyBaseID:FBgn0032703 Length:214 Species:Drosophila melanogaster


Alignment Length:222 Identity:49/222 - (22%)
Similarity:83/222 - (37%) Gaps:41/222 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 EDQTNEVEALDSIYCGDMEILATEPHHKFQIPIATEEYSSEEPEKGLACKLVFTFTATYPDGAPV 71
            |.||.|.|||.|||.||....        :|...|.:|...|.:...:..:...:...|||.||.
  Fly     6 EQQTEEREALQSIYEGDTNFK--------EIDSVTFQYKYGEEDNYKSFLVELKWGENYPDEAPA 62

  Fly    72 VEIEEPENFEDMFETRLLEHLQKTIEENLGMEMIFSLVSSAQEWLNERWDEHKFHQEELREQKLR 136
            :      |....:...||..:::.|:..|..|        |.:||........|   |..:..|.
  Fly    63 I------NMNAFYNRNLLPAVKEGIQTALSTE--------ADQWLGCGMTYTLF---ECLKDNLE 110

  Fly   137 EIEEEERKKFEGTRVTVESFLKWKLEFEESTGIAAKRE--KNNVSKKQTGRELFMCDNTLNDSD- 198
            ::..|:.:......:..:.....|:....:...:.|:|  |.:::|.|..|:....|:. .|.: 
  Fly   111 QLTAEQPESAPTVALVDDGVGALKISDPNADAESKKKEPKKEHLTKAQKRRQWERTDHK-GDRER 174

  Fly   199 -------IKFLLEAGENIENVKIDETL 218
                   :|.|.:.|.     |.|::|
  Fly   175 GWDWVDLVKHLSQTGG-----KNDDSL 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5515NP_001262901.1 RWD 4..116 CDD:283440 28/108 (26%)
DFRP_C 149..>198 CDD:293151 9/50 (18%)
CG10343NP_609900.1 RWD 6..109 CDD:283440 32/127 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4018
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.