DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5515 and Rwdd4a

DIOPT Version :9

Sequence 1:NP_001262901.1 Gene:CG5515 / 42875 FlyBaseID:FBgn0039163 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_987103.1 Gene:Rwdd4a / 192174 MGIID:2681000 Length:188 Species:Mus musculus


Alignment Length:211 Identity:56/211 - (26%)
Similarity:83/211 - (39%) Gaps:42/211 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 EDQTNEVEALDSIYCGDMEILATEPHHKFQIPIATEEYSSEEPEKGLACKLVFTFTATYPDGAPV 71
            |||..|:|||.|||.||.......|        .:.:|...|.....|..:..::|.|||..|||
Mouse     5 EDQEMELEALRSIYEGDNSFRELSP--------VSFQYRIGEDGDPKAFLIEVSWTETYPQTAPV 61

  Fly    72 VEIEEPEN--FEDMFETRLLEHLQKTIEENLGMEMIFSLVSSAQEWLNERWDEHKFHQEELREQK 134
            :.:....|  .....:..:|..||:.:|.|||..|.::|...|::           |:|:..|  
Mouse    62 ISMNAFFNNTISSAVKQSILAKLQEAVEVNLGTAMTYTLFEYAKD-----------HKEQFME-- 113

  Fly   135 LREIEEEERKKFEGTRVT-VESFLKWKLEFEESTGIAAKREKNNVSKKQTGRELFMCDNTLNDSD 198
                     ....|...| |.:.:  .:|...:...:.|:||.....|...|:|  .|.|    |
Mouse   114 ---------NHHPGNSATPVANII--SVETPTTAPSSKKKEKKEQLSKAQKRKL--ADKT----D 161

  Fly   199 IKFLLEAGEN-IENVK 213
            .|..|..|.| ::.||
Mouse   162 HKGELPRGWNWVDVVK 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5515NP_001262901.1 RWD 4..116 CDD:283440 34/110 (31%)
DFRP_C 149..>198 CDD:293151 11/49 (22%)
Rwdd4aNP_987103.1 RWD 4..107 CDD:283440 34/120 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 132..167 10/40 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4018
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.