DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHORD and git7

DIOPT Version :9

Sequence 1:NP_651226.1 Gene:CHORD / 42874 FlyBaseID:FBgn0029503 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_595340.1 Gene:git7 / 2540962 PomBaseID:SPBC36.12c Length:379 Species:Schizosaccharomyces pombe


Alignment Length:167 Identity:43/167 - (25%)
Similarity:78/167 - (46%) Gaps:18/167 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   202 VKENDDKKVVQCRYDWHQTATNVVMAIYAKKY-DYSQSVI-ELNPIRLHVNLVFPEQDNARFDLD 264
            :::|::|...:.||||.||:.::.:.|||||. |...|:: |.|.:::.:.|    :|.:.|.|.
pombe   173 IEKNEEKLSNRIRYDWSQTSFSLNIDIYAKKVKDEDVSLLMEKNTLKIEIKL----EDGSIFSLV 233

  Fly   265 LE-LRGIVNVSNASAHMYGTKVEIKL-PKLEPGSWSNL--NFPNKKLPVVKK--------SQVEE 317
            |: |...:....:|..::.:||||.| .|:....|..|  :..|..:.|..|        ...:.
pombe   234 LDPLYEEIVPEKSSFKLFSSKVEITLIKKVSEIKWEALVKSPANNSVNVYAKDSNHSSASGNTKN 298

  Fly   318 KKKQEESDEEFFDLDDIKAETSFRLSEMSMQSPNNLD 354
            |.|..:|..:..||::.:......|:.:......|.|
pombe   299 KAKDWDSLAKLADLEEDEPTGEAALANLFQNLYKNAD 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHORDNP_651226.1 CHORD 3..63 CDD:282781
CHORD 138..199 CDD:282781
p23_melusin_like 213..301 CDD:107238 30/93 (32%)
git7NP_595340.1 SGT1 1..379 CDD:227422 43/167 (26%)
p23_CS_SGT1_like 187..271 CDD:107223 27/87 (31%)
SGS 301..379 CDD:282811 7/35 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.