DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHORD and D1054.3

DIOPT Version :9

Sequence 1:NP_651226.1 Gene:CHORD / 42874 FlyBaseID:FBgn0029503 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_505751.1 Gene:D1054.3 / 179494 WormBaseID:WBGene00008371 Length:198 Species:Caenorhabditis elegans


Alignment Length:135 Identity:34/135 - (25%)
Similarity:55/135 - (40%) Gaps:30/135 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 RYDWHQTATNVVMAIYAKKY---DYSQSVIELNPIRLHVNLVFPEQDNARFDLDLELRGIVNVSN 275
            |:||.|:.|:|.:.|..:..   |.|.|:.:.|      .|...:.|...|  ..:|.|.|...:
 Worm     6 RHDWFQSETDVTLTILKRGVPLDDCSVSLSDNN------TLTVKQCDEILF--YGQLSGQVKKDD 62

  Fly   276 ASAHMYGTKVEIKLPKLEPGS-WSNL----------------NFPNKKLPVVKKS--QVEEKKKQ 321
            .:......|||::|||..... |::|                |..:.....|||:  .:|::..:
 Worm    63 LTVKCTAAKVEVRLPKFARNERWASLLKDGQGVAASVQSVSPNPESAPTTTVKKNWDAIEKQAVK 127

  Fly   322 EESDE 326
            ||.||
 Worm   128 EEEDE 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHORDNP_651226.1 CHORD 3..63 CDD:282781
CHORD 138..199 CDD:282781
p23_melusin_like 213..301 CDD:107238 25/106 (24%)
D1054.3NP_505751.1 PLN03088 <3..197 CDD:215568 34/135 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.