DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TBC1d7 and TBC1D7

DIOPT Version :9

Sequence 1:NP_651223.2 Gene:TBC1d7 / 42869 FlyBaseID:FBgn0039158 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_001137436.1 Gene:TBC1D7 / 51256 HGNCID:21066 Length:293 Species:Homo sapiens


Alignment Length:293 Identity:99/293 - (33%)
Similarity:153/293 - (52%) Gaps:24/293 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ERNFRSIYYEKCQINSVEEQKSLNKLLQDDIRNLSKLKQFCMNYTVPNNNRSYLWALVMGILPLH 69
            :|||||:||||.....|||:|||..||:||..:..||..|...:.:|:..|:.:|.:::||||.|
Human     6 QRNFRSVYYEKVGFRGVEEKKSLEILLKDDRLDTEKLCTFSQRFPLPSMYRALVWKVLLGILPPH 70

  Fly    70 KASTAYVRDQRREMYEDLRRAVTVLRFTDHKQKEQPFMWLIDHKKKAQVMHTMWLIESNRLWHGN 134
            ..|.|.|...|:|.|.|:..|:.|:||..            |...:|:|...|:.:||.:| ..:
Human    71 HESHAKVMMYRKEQYLDVLHALKVVRFVS------------DATPQAEVYLRMYQLESGKL-PRS 122

  Fly   135 TSASLQADDMHFIEIVRTLLQIFDDNVETYWIAKGFY-----KYTRELKKECVKLKEQTQNILKR 194
            .|..|:.||..|:.|.:.:.::.:|:|:.|||.:.|.     || |:...:..|..||..|:   
Human   123 PSFPLEPDDEVFLAIAKAMEEMVEDSVDCYWITRRFVNQLNTKY-RDSLPQLPKAFEQYLNL--- 183

  Fly   195 EDLSLLNHLELLGLFDGNSTLLDNWYITCFAGIICTTHLVKIWDKVCGGSRKIVVFLFVELVKDI 259
            ||..||.||.:...  ......|.|:..||||.:..:.|.::||||..||.||:||:.||::...
Human   184 EDGRLLTHLRMCSA--APKLPYDLWFKRCFAGCLPESSLQRVWDKVVSGSCKILVFVAVEILLTF 246

  Fly   260 RSSILKQTSLADVKRLIETVKDLDGVIIVNKAI 292
            :..::...|...:.:.:|.:.......||:|||
Human   247 KIKVMALNSAEKITKFLENIPQDSSDAIVSKAI 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TBC1d7NP_651223.2 None
TBC1D7NP_001137436.1 RabGAP-TBC <147..251 CDD:321955 38/109 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9538
Inparanoid 1 1.050 153 1.000 Inparanoid score I4353
Isobase 1 0.950 - 0 Normalized mean entropy S7099
OMA 1 1.010 - - QHG52857
OrthoDB 1 1.010 - - D1440539at2759
OrthoFinder 1 1.000 - - FOG0008411
OrthoInspector 1 1.000 - - oto91845
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR13530
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6401
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1211.990

Return to query results.
Submit another query.