DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6178 and acsf3

DIOPT Version :9

Sequence 1:NP_651221.1 Gene:CG6178 / 42867 FlyBaseID:FBgn0039156 Length:544 Species:Drosophila melanogaster
Sequence 2:XP_021329817.1 Gene:acsf3 / 562292 ZFINID:ZDB-GENE-121026-3 Length:579 Species:Danio rerio


Alignment Length:557 Identity:135/557 - (24%)
Similarity:243/557 - (43%) Gaps:91/557 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 ILDKYKSFGDRTVLVDAVNGVEYSASFMHKSIVRLAYILQKLGVKQNDVVG----LSSENSVNFA 91
            :..:..::||:..::|......|.:.:.:..|: ..:|.:.|..:..|:.|    ....|..::.
Zfish    55 VFSRAPAYGDKVAIMDHSGSHTYHSLYKNSKIL-AGHITKALTCQSGDLQGKRISFLCANDASYT 118

  Fly    92 LAMFAGLAVGATVAPLNVTYSDREVDHAINLSKPKIIFASKITIDRVAKVASKNKFVKGI--IAL 154
            :|.:|....|....||...:...|:::.|:.|:..::.|.:..:|.:..:|.|    .|:  :.|
Zfish   119 VAQWASWMCGGIAVPLYRKHPLSELEYVISDSQSSLLVAGQSFVDTLEPLAQK----LGLPCLKL 179

  Fly   155 SGTSKKFKNIYDLKELMEDEKFKTQPDFTSPAANKDEDVSLIVCSSGTTGLPKGVQLTQMNLLAT 219
            ..||.:|::...|.|           |..|..|   |..::::.:|||||.||||..|..:|.|.
Zfish   180 PATSSQFEDTQTLPE-----------DMISDWA---ERPAMLIYTSGTTGRPKGVLHTHSSLQAM 230

  Fly   220 LDSQIQPTVIPMEEVTLLTVIPWFHAFGCLT-LITTACVGARLVYLPKFEEKLFLSAIEKYRVMM 283
            :...:.......::|.|.| :|..|..|.:. |:....|||..:.||.|      ||.:.:..::
Zfish   231 VQGLVSEWAWHKDDVILHT-LPLHHVHGIVNKLMCPLWVGATCIMLPDF------SAQKVWEQLI 288

  Fly   284 AFMVPPLMVFLAKHPIVDK----YD----------------LSSLMVLLCGAAPLSRE------- 321
            ....|.:.||:|...|..|    ||                ...:.:::.|:|.|.:.       
Zfish   289 CSKSPMVNVFMAVPTIYSKLIEYYDQHFTQPQVQDFIRAVCKERIRLMVSGSAALPQPVLERWAE 353

  Fly   322 -TEDQIKERIGVPFIRQGYGLSESTLSVLVQNDEFCKPGSVGVLKVGIYAK-------VIDPDTG 378
             |:..:.||.|:..|  |..||.|.....|       ||:|||...|:..:       ||...|.
Zfish   354 ITDHVLLERYGMTEI--GMALSNSYKGPRV-------PGAVGVPLPGVEVRIMMNSSIVIAEGTS 409

  Fly   379 K-------LLGANERGELCFKGDGIMKGYIGDTKSTQTAI-KDGWLHTGDIGYYDDDFEFFIVDR 435
            |       |.|  :.|||..:|..:.:.|....:.|:.:. :|.|..|||...|.|.. ::|:.|
Zfish   410 KGTQVKAGLEG--KEGELLVRGSSVFQKYWNKPQETEESFTEDRWFKTGDTALYRDGV-YWIMGR 471

  Fly   436 IK-ELIKYKGYQVPPAEIEALLLTNDKIKDAAVIGKPDEEAGELPLAFVVKQANVQLTENEVIQF 499
            .. ::||..||::...::|..||.:..|.|.||||.||...|:...|.|..:....:..:::..:
Zfish   472 TSVDIIKSGGYKISALDVERHLLAHPDITDVAVIGAPDATWGQKVTAVVQMRKGKTMILSDLKAW 536

  Fly   500 VNDNASPAKRLRGGVIFVDEIPKNPSGKILRR-ILRE 535
            ..::.: :..:..|:|.|:::|:|..||:.:: :||:
Zfish   537 AREHMA-SYSIPTGLILVEDMPRNQMGKVNKKDLLRQ 572

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6178NP_651221.1 PLN02246 26..537 CDD:215137 135/557 (24%)
Firefly_Luc_like 43..529 CDD:213279 131/536 (24%)
acsf3XP_021329817.1 MCS 64..566 CDD:213307 132/540 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0318
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.