DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6178 and Acsm1

DIOPT Version :9

Sequence 1:NP_651221.1 Gene:CG6178 / 42867 FlyBaseID:FBgn0039156 Length:544 Species:Drosophila melanogaster
Sequence 2:NP_001101972.2 Gene:Acsm1 / 361638 RGDID:1306813 Length:577 Species:Rattus norvegicus


Alignment Length:484 Identity:120/484 - (24%)
Similarity:212/484 - (43%) Gaps:36/484 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 QKLGVKQNDVVGLSSENSVNFALAMFAGLAVGATVAPLNVTYSDREVDHAINLSKPKIIFASKIT 134
            |..|::..|.:.|.......:.|.....:..|....|.......:::.:.|.:|:.|.|..:...
  Rat   104 QTCGLQHGDRLALILPRVPEWWLVTVGCIRTGVIFIPGTAQMKAKDILYRIQMSQAKAIVTTDSL 168

  Fly   135 IDRVAKVASKNKFVKGIIALSGTSKKFKNIYDLKELMEDEKFKTQPDFTSPAANKDEDVSLIVCS 199
            :..|..|||:...:|..|.:|  ....:...:.:.|:.    ...||.|. ..:|.:|..:|..:
  Rat   169 VPEVESVASECPGLKTKIVVS--DHNHEGWLNFRTLLR----SASPDHTC-VKSKMKDPMVIFFT 226

  Fly   200 SGTTGLPKGVQLTQ-MNLLATLDSQIQPTVIPMEEVTLLTVIP-WFHA-FGCLTLITTACVGARL 261
            |||||.||..:..| :...:::.|..:...:...:|......| |..| .|||....||.....:
  Rat   227 SGTTGYPKMAKHNQGLAFRSSVPSCRKFLKLKTSDVIWCMSDPGWILATVGCLLEPWTAGATVFV 291

  Fly   262 VYLPKFEEKLFLSAIEKYRVMMAFMVPPLMVFLAKHPIVDKYDLSSLMV-----LLCGAAPLSRE 321
            ..||:|:.|:.:..:.||.:......|      |.:.:|.:.::|:|..     ...|...|..|
  Rat   292 HNLPQFDPKVIVETLFKYPITQCLAAP------AVYRMVLQKNISNLRFPTLEHCATGGESLLPE 350

  Fly   322 TEDQIKERIGVPFIRQGYGLSESTLSVLVQNDEFCKPGSVGVLKVGIYAKVIDPDTGKLLGANER 386
            ..:|.|:|.|:. |.:.||.||:.::..:..:...|.||:|...:....::|| :.|.:|..|..
  Rat   351 EYEQWKQRTGLS-IHEVYGQSETGITCAIFREMKVKRGSIGKAILPFDIQIID-EKGNILPPNTE 413

  Fly   387 GELCFKGD-----GIMKGYIGDTKSTQTAIKDGWLHTGDIGYYDDDFEFFIVDRIKELIKYKGYQ 446
            |.:..:..     |:..||....:.|.......:.::||....|:|...:.:.|..::|...||:
  Rat   414 GYIGIRIKPTRPLGLFVGYENSPEKTSEVECGDFYNSGDRATIDEDGYIWFLGRSDDVINASGYR 478

  Fly   447 VPPAEIEALLLTNDKIKDAAVIGKPDEEAGELPLAFVV------KQANVQLTENEVIQFVNDNAS 505
            :.|.|:|..|:.:..:.::||:..||::.||:..||:|      .....||.: |:.:.|....:
  Rat   479 IGPTEVENALVEHPAVSESAVVSSPDKDRGEVVKAFIVLNPEFLSHDQEQLIK-ELQEHVKSVTA 542

  Fly   506 PAKRLRGGVIFVDEIPKNPSGKILRRILR 534
            |.|..| .|.||.|:||..:|||.|:.||
  Rat   543 PYKYPR-KVEFVSELPKTITGKIKRKELR 570

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6178NP_651221.1 PLN02246 26..537 CDD:215137 120/484 (25%)
Firefly_Luc_like 43..529 CDD:213279 116/477 (24%)
Acsm1NP_001101972.2 AFD_class_I 46..573 CDD:302604 120/484 (25%)
Acs 46..570 CDD:223442 118/482 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D333840at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.