DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6178 and ACSM6

DIOPT Version :9

Sequence 1:NP_651221.1 Gene:CG6178 / 42867 FlyBaseID:FBgn0039156 Length:544 Species:Drosophila melanogaster
Sequence 2:NP_997204.2 Gene:ACSM6 / 142827 HGNCID:31665 Length:480 Species:Homo sapiens


Alignment Length:425 Identity:89/425 - (20%)
Similarity:157/425 - (36%) Gaps:69/425 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 SIVRLAYILQKLGVKQNDVVGLSSENSVNFAL--------AMFAGLAVGATVAPLNVTYSDREVD 117
            |..|:..:.:|.....:|...||..:.:...|        ...|.:.:|.|..|.:...:.:::.
Human    87 SFERMTQLSKKAASILSDTCALSHGDRLMIILPPTPEAYWICLACVRLGITFVPGSPQLTAKKIR 151

  Fly   118 HAINLSKPKIIFASKITIDRVAKVASKNKFVKGIIALSGTSKKFKNIYDLKELMEDEKFKTQPDF 182
            :.:.:||.:.|.|::.....|....|....:|..:.:|  .|.:....|.|:|::     ..|..
Human   152 YQLRMSKAQCIVANEAMAPVVNSAVSDCPTLKTKLLVS--DKSYDGWLDFKKLIQ-----VAPPK 209

  Fly   183 TSPAANKDEDVSLIVCSSGTTGLPKGVQLTQMNLLATLDS------QIQPTVIPME-------EV 234
            .:....|.:|...|..:.||||.||.|:.:|..|......      .:|||.:...       .:
Human   210 QTYMRTKSQDPMAIFFTKGTTGAPKMVEYSQYGLGMGFSQASRRWMDLQPTDVLWSLGDAFGGSL 274

  Fly   235 TLLTVI-PWFHAFGCLTLITTACVGARLVYLPKFEEKLFLSAIEKYRVMMAFMVPPLMVFLAKHP 298
            :|..|: .||..         |||  .|.::|.|..:..|:.:.::.:......|.:...|.:|.
Human   275 SLSAVLGTWFQG---------ACV--FLCHMPTFCPETVLNVLSRFPITTLSANPEMYQELLQHK 328

  Fly   299 IVDKYDLSSLMVLLCGAAPLSRETEDQIKERIGVPFIRQGYGLSESTLSVLVQNDEFCKPGSVGV 363
            ....|...||...:....|:|....:..| ||....|.:|||.:|:.|..........||.|:|.
Human   329 CFTSYRFKSLKQCVAAGGPISPGVIEDWK-RITKLDIYEGYGQTETGLLCATSKTIKLKPSSLGK 392

  Fly   364 LKVGIYAKVIDPDTGKLLGANERGELCFKGDGIMKGYIGDTKSTQTA---------------IKD 413
            .......:::| :...||...|.|.:..:           .|..|.|               .:.
Human   393 PLPPYIVQIVD-ENSNLLPPGEEGNIAIR-----------IKLNQPASLYCPHMVSWEEYASARG 445

  Fly   414 GWLH-TGDIGYYDDDFEFFIVDRIKELIKYKGYQV 447
            ..|: |||.|..|:|..|:...|:.::....|.::
Human   446 HMLYLTGDRGIMDEDGYFWWSGRVDDVANALGQRL 480

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6178NP_651221.1 PLN02246 26..537 CDD:215137 89/425 (21%)
Firefly_Luc_like 43..529 CDD:213279 89/425 (21%)
ACSM6NP_997204.2 AFD_class_I 45..480 CDD:302604 89/423 (21%)
AMP-binding 76..472 CDD:278902 88/415 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D333840at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.