DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6178 and ACSM2A

DIOPT Version :9

Sequence 1:NP_651221.1 Gene:CG6178 / 42867 FlyBaseID:FBgn0039156 Length:544 Species:Drosophila melanogaster
Sequence 2:NP_001295101.1 Gene:ACSM2A / 123876 HGNCID:32017 Length:577 Species:Homo sapiens


Alignment Length:498 Identity:131/498 - (26%)
Similarity:215/498 - (43%) Gaps:53/498 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 GVKQNDVVGLSSENSVNFALAMFAGLAVGATVAPLNVTYSDREVDHAINLSKPKIIFASKITIDR 137
            |:::.|.|.:.......:.|.:...:..|....|..:.....::.:.:.:||.|.|.|....|..
Human   102 GLQRGDRVAVVLPRVPEWWLVILGCIRAGLIFMPGTIQMKSTDILYRLQMSKAKAIVAGDEVIQE 166

  Fly   138 VAKVASKNKFVKGIIALSGTSKKFKNIYDLKELMEDEKFKTQPDFTSPAANKDEDVSLIVCSSGT 202
            |..|||:...::  |.|..:.|......:.|:|:.:.........|.     .::.|.|..:|||
Human   167 VDTVASECPSLR--IKLLVSEKSCDGWLNFKKLLNEASTTHHCVETG-----SQEASAIYFTSGT 224

  Fly   203 TGLPKGVQ--LTQMNLLATLD--------SQIQPTVIPMEEVTLLTVI-----PWFHAFGCLTLI 252
            :||||..:  .:.:.|.|.:|        |.|..|:  .:...:|.::     ||  |.|     
Human   225 SGLPKMAEHSYSSLGLKAKMDAGWTGLQASDIMWTI--SDTGWILNILCSLMEPW--ALG----- 280

  Fly   253 TTACVGARLVYLPKFEEKLFLSAIEKYRVMMAFMVPPLMVFLAKHPIVDKYDLSSLMVLLCGAAP 317
              ||....|  ||||:..:.|..:..|.: .:.|..|::..:.....:..|....|...:.....
Human   281 --ACTFVHL--LPKFDPLVILKTLSSYPI-KSMMGAPIVYRMLLQQDLSSYKFPHLQNCVTVGES 340

  Fly   318 LSRETEDQIKERIGVPFIRQGYGLSESTLSVLVQNDEFCKPGSVGVLKVGIYAKVIDPDTGKLLG 382
            |..||.:..:.:.|:. ||:.||.:|:.|:.:|......|||.:|........::|| |.|.:|.
Human   341 LLPETLENWRAQTGLD-IRESYGQTETGLTCMVSKTMKIKPGYMGTAASCYDVQIID-DKGNVLP 403

  Fly   383 ANERGELCFKGD-----GIMKGYIGDTKSTQTAIK-DGWLHTGDIGYYDDDFEFFIVDRIKELIK 441
            ....|::..:..     ||..||:.:...|...|: |.|| .||.|..|:|..|..:.|..::|.
Human   404 PGTEGDIGIRVKPIRPIGIFSGYVDNPDKTAANIRGDFWL-LGDRGIKDEDGYFQFMGRANDIIN 467

  Fly   442 YKGYQVPPAEIEALLLTNDKIKDAAVIGKPDEEAGELPLAFVVKQANV------QLTENEVIQFV 500
            ..||::.|:|:|..|:.:..:.:.|||..||...||:..||||..:..      |||: |:.|.|
Human   468 SSGYRIGPSEVENALMEHPAVVETAVISSPDPVRGEVVKAFVVLASQFLSHDPEQLTK-ELQQHV 531

  Fly   501 NDNASPAKRLRGGVIFVDEIPKNPSGKILRRILREMLKKQKSK 543
            ....:|.|..| .:.||..:||..:|||.|..||:...|...|
Human   532 KSVTAPYKYPR-KIEFVLNLPKTVTGKIQRAKLRDKEWKMSGK 573

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6178NP_651221.1 PLN02246 26..537 CDD:215137 129/490 (26%)
Firefly_Luc_like 43..529 CDD:213279 125/482 (26%)
ACSM2ANP_001295101.1 AFD_class_I 40..568 CDD:388389 129/491 (26%)
Coenzyme A binding. /evidence=ECO:0000269|PubMed:19345228 469..471 0/1 (0%)
Coenzyme A binding. /evidence=ECO:0000269|PubMed:19345228 540..542 0/1 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D333840at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.