DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p38a and CMK1

DIOPT Version :9

Sequence 1:NP_001163711.1 Gene:p38a / 42866 FlyBaseID:FBgn0015765 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_116669.1 Gene:CMK1 / 850568 SGDID:S000001910 Length:446 Species:Saccharomyces cerevisiae


Alignment Length:303 Identity:78/303 - (25%)
Similarity:132/303 - (43%) Gaps:67/303 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 VGSGAYGQVSKAVVRGTNMHVAIKKLARPF--QSAVHAKRTYRELRLLKHMDHENVIGLLDIFHP 93
            :|:|.:|.|.:|....|...||:|.|.:..  .:.|..:..|.||.:|:.:.|.|::...|.|  
Yeast    43 LGAGTFGVVRQAKNTETGEDVAVKILIKKALKGNKVQLEALYDELDILQRLHHPNIVAFKDWF-- 105

  Fly    94 HPANGSLENFQQVYLVTHLMDAD--LNNIIRMQHLSDDHVQFLVYQILRGLKYIHSAGVIHRDLK 156
                   |:..:.|::|.|....  .:.|::....:::....::.:||..:||:||..::|||||
Yeast   106 -------ESKDKFYIITQLAKGGELFDRILKKGKFTEEDAVRILVEILSAVKYMHSQNIVHRDLK 163

  Fly   157 PSN---IAVNEDCELRILDFGLARPTENE---------MTGYVATRWYRAPEIMLNWMHYDQTVD 209
            |.|   |..:::..|.:.|||:|:..:::         ..|||      |||::....| .:..|
Yeast   164 PENLLYIDKSDESPLVVADFGIAKRLKSDEELLYKPAGSLGYV------APEVLTQDGH-GKPCD 221

  Fly   210 IWSVGCIMAELITRRTLFPGTDHIHQLNLIMEML-----GTPPAEFLKKISSESARSYIQSLPPM 269
            |||:|.|...|:...:.|       :...:.:.|     |..|.:|        .|.|..|: ..
Yeast   222 IWSIGVITYTLLCGYSAF-------RAERVQDFLDECTTGEYPVKF--------HRPYWDSV-SN 270

  Fly   270 KGRSFKNVFKNANPLAIDLLEKMLELDAEKRITAEEALSHPYL 312
            |.:.|              :.|.|.||..||.||.|.|..|::
Yeast   271 KAKQF--------------ILKALNLDPSKRPTAAELLEDPWI 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p38aNP_001163711.1 STKc_p38 9..354 CDD:143356 78/303 (26%)
S_TKc 25..312 CDD:214567 78/301 (26%)
CMK1NP_116669.1 STKc_CAMK 36..298 CDD:270687 77/300 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.