DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p38a and MPK2

DIOPT Version :9

Sequence 1:NP_001163711.1 Gene:p38a / 42866 FlyBaseID:FBgn0015765 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_564746.1 Gene:MPK2 / 842248 AraportID:AT1G59580 Length:376 Species:Arabidopsis thaliana


Alignment Length:345 Identity:165/345 - (47%)
Similarity:232/345 - (67%) Gaps:10/345 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 RTEWEIPDIYQDLQPVGSGAYGQVSKAVVRGTNMHVAIKKLARPFQSAVHAKRTYRELRLLKHMD 80
            :|.:||...|..::|:|.||||.|..:|.|.:|..|||||:...|::.:.|.||.|||:||:|:.
plant    23 QTLFEIDTKYVPIKPIGRGAYGVVCSSVNRESNERVAIKKIHNVFENRIDALRTLRELKLLRHLR 87

  Fly    81 HENVIGLLDIFHPHPANGSLENFQQVYLVTHLMDADLNNIIR-MQHLSDDHVQFLVYQILRGLKY 144
            ||||:.|.|:.   .||.. .:|:.||||..|||.||:.||: .|.||:||.|:.::|:||||||
plant    88 HENVVALKDVM---MANHK-RSFKDVYLVYELMDTDLHQIIKSSQVLSNDHCQYFLFQLLRGLKY 148

  Fly   145 IHSAGVIHRDLKPSNIAVNEDCELRILDFGLARPTENE---MTGYVATRWYRAPEIMLNWMHYDQ 206
            ||||.::||||||.|:.||.:|:|:|.||||||.:..:   ||.||.||||||||::|...:|..
plant   149 IHSANILHRDLKPGNLLVNANCDLKICDFGLARTSNTKGQFMTEYVVTRWYRAPELLLCCDNYGT 213

  Fly   207 TVDIWSVGCIMAELITRRTLFPGTDHIHQLNLIMEMLGTPPAEFLKKISSESARSYIQSLPPMKG 271
            ::|:||||||.|||:.|:.:||||:.::|:.||:.:||:...|.|:.|.:..|:.||:|||...|
plant   214 SIDVWSVGCIFAELLGRKPVFPGTECLNQIKLIINILGSQREEDLEFIDNPKAKRYIESLPYSPG 278

  Fly   272 RSFKNVFKNANPLAIDLLEKMLELDAEKRITAEEALSHPYLEKYAEPSVEQTSP-PYDHSF-EDM 334
            .||..::..||.||||||:|||.||..|||:..|||.|||:....:||....:. |.|... ||.
plant   279 ISFSRLYPGANVLAIDLLQKMLVLDPSKRISVTEALQHPYMAPLYDPSANPPAQVPIDLDVDEDE 343

  Fly   335 DLPVDKWKELIYKEVTNFKP 354
            ||..:..:||::||:.::.|
plant   344 DLGAEMIRELMWKEMIHYHP 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p38aNP_001163711.1 STKc_p38 9..354 CDD:143356 164/343 (48%)
S_TKc 25..312 CDD:214567 148/290 (51%)
MPK2NP_564746.1 STKc_TEY_MAPK 26..363 CDD:143363 163/340 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0660
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm974
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.