DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p38a and MPK1

DIOPT Version :9

Sequence 1:NP_001163711.1 Gene:p38a / 42866 FlyBaseID:FBgn0015765 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_001031017.1 Gene:MPK1 / 837559 AraportID:AT1G10210 Length:370 Species:Arabidopsis thaliana


Alignment Length:350 Identity:159/350 - (45%)
Similarity:228/350 - (65%) Gaps:16/350 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 RTEWEIPDIYQDLQPVGSGAYGQVSKAVVRGTNMHVAIKKLARPFQSAVHAKRTYRELRLLKHMD 80
            :|.:||...|..::|:|.||||.|..:|...||..|||||:...:::.:.|.||.|||:||:|:.
plant    23 QTLFEIDTKYMPIKPIGRGAYGVVCSSVNSDTNEKVAIKKIHNVYENRIDALRTLRELKLLRHLR 87

  Fly    81 HENVIGLLDIFHP-HPANGSLENFQQVYLVTHLMDADLNNIIR-MQHLSDDHVQFLVYQILRGLK 143
            |||||.|.|:..| |..     :|:.||||..|||.||:.||: .|.||:||.|:.::|:|||||
plant    88 HENVIALKDVMMPIHKM-----SFKDVYLVYELMDTDLHQIIKSSQVLSNDHCQYFLFQLLRGLK 147

  Fly   144 YIHSAGVIHRDLKPSNIAVNEDCELRILDFGLARPTENE---MTGYVATRWYRAPEIMLNWMHYD 205
            |||||.::||||||.|:.||.:|:|:|.||||||.:..:   ||.||.||||||||::|...:|.
plant   148 YIHSANILHRDLKPGNLLVNANCDLKICDFGLARASNTKGQFMTEYVVTRWYRAPELLLCCDNYG 212

  Fly   206 QTVDIWSVGCIMAELITRRTLFPGTDHIHQLNLIMEMLGTPPAEFLKKISSESARSYIQSLPPMK 270
            .::|:||||||.|||:.|:.:|.||:.::||.||:.:||:...|.|:.|.:..|:.||:|||...
plant   213 TSIDVWSVGCIFAELLGRKPIFQGTECLNQLKLIVNILGSQREEDLEFIDNPKAKRYIRSLPYSP 277

  Fly   271 GRSFKNVFKNANPLAIDLLEKMLELDAEKRITAEEALSHPYLEKYAEPSVEQTSPPYDHSFE--- 332
            |.|...::..|:.||||||:|||..|..|||:..|||.|||:....:|:   .:||.....:   
plant   278 GMSLSRLYPGAHVLAIDLLQKMLVFDPSKRISVSEALQHPYMAPLYDPN---ANPPAQVPIDLDV 339

  Fly   333 DMDLPVDKWKELIYKEVTNFKPPPS 357
            |.||..:..:|:::.|:.::.|..|
plant   340 DEDLREEMIREMMWNEMLHYHPQAS 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p38aNP_001163711.1 STKc_p38 9..354 CDD:143356 157/345 (46%)
S_TKc 25..312 CDD:214567 145/291 (50%)
MPK1NP_001031017.1 STKc_TEY_MAPK 26..361 CDD:143363 156/342 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0660
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm974
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.