DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p38a and MPK16

DIOPT Version :9

Sequence 1:NP_001163711.1 Gene:p38a / 42866 FlyBaseID:FBgn0015765 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_197402.1 Gene:MPK16 / 832019 AraportID:AT5G19010 Length:567 Species:Arabidopsis thaliana


Alignment Length:359 Identity:148/359 - (41%)
Similarity:216/359 - (60%) Gaps:20/359 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 TEWEIPDIYQDLQPVGSGAYGQVSKAVVRGTNMHVAIKKLARPFQSAVHAKRTYRELRLLKHMDH 81
            ||:.....|:..:.:|.|:||.|..|....|...|||||:...|:....|.|..||::||:.:.|
plant    17 TEYGEGSRYRIEEVIGKGSYGVVCSAYDTHTGEKVAIKKINDIFEHVSDATRILREIKLLRLLRH 81

  Fly    82 ENVIGLLDIFHPHPANGSLENFQQVYLVTHLMDADLNNIIRM-QHLSDDHVQFLVYQILRGLKYI 145
            .:::.:..|..|    .|...|:.:|:|..||::||:.:|:. ..|:.:|.||.:||:|||||||
plant    82 PDIVEIKHILLP----PSRREFRDIYVVFELMESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYI 142

  Fly   146 HSAGVIHRDLKPSNIAVNEDCELRILDFGLAR------PTENEMTGYVATRWYRAPEIMLNWM-H 203
            |:|.|.||||||.||..|.||:|:|.||||||      ||....|.|||||||||||:..::. .
plant   143 HTANVFHRDLKPKNILANADCKLKICDFGLARVAFNDTPTAIFWTDYVATRWYRAPELCGSFFSK 207

  Fly   204 YDQTVDIWSVGCIMAELITRRTLFPGTDHIHQLNLIMEMLGTPPAEFLKKISSESARSYIQSLPP 268
            |...:||||:|||.|||:|.:.||||.:.:|||:|:.:|||||.||.:.::.:|.||.|:.|:..
plant   208 YTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMTDMLGTPSAEAIGRVRNEKARRYLSSMRK 272

  Fly   269 MKGRSFKNVFKNANPLAIDLLEKMLELDAEKRITAEEALSHPYLEKYAEPSVEQTSPP---YDHS 330
            .|...|.:.|.:.:|||:.||||||..:.:.|.||||||:..|.:..|:...|.::.|   .:..
plant   273 KKPIPFSHKFPHTDPLALRLLEKMLSFEPKDRPTAEEALADVYFKGLAKVEREPSAQPVTKLEFE 337

  Fly   331 FEDMDLPVDKWKELIYKEVTNFKPPPSYAQVLKD 364
            ||...:..:..:||||:|...:.|     ::||:
plant   338 FERRRITKEDVRELIYRESLEYHP-----KMLKE 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p38aNP_001163711.1 STKc_p38 9..354 CDD:143356 145/347 (42%)
S_TKc 25..312 CDD:214567 132/294 (45%)
MPK16NP_197402.1 STKc_TDY_MAPK 24..361 CDD:143364 143/340 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0660
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.