DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p38a and AT4G01595

DIOPT Version :9

Sequence 1:NP_001163711.1 Gene:p38a / 42866 FlyBaseID:FBgn0015765 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_680555.2 Gene:AT4G01595 / 828086 AraportID:AT4G01595 Length:140 Species:Arabidopsis thaliana


Alignment Length:120 Identity:44/120 - (36%)
Similarity:69/120 - (57%) Gaps:6/120 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   204 YDQTVDIWSVGCIMAELITRRTLFPGTDHIHQLNLIMEMLGTPPAEFLKKISSESARSYIQSLPP 268
            |...:|:||:|||.||::|.:.||||...:|||.||.::||||.::.:..:.::.||.|:..:..
plant    20 YTPAIDVWSIGCIFAEVLTWKPLFPGKSVVHQLELITDLLGTPKSDAISGVRNDKARKYLTEMRK 84

  Fly   269 MKGRSFKNVFKNANPLAIDLLEKMLELDAEKRITAEEALSHPYLEKYAEPSVEQT 323
            ....:|...|..|:|||:.||:::|..|   |.|..|..|.   :|..:..||.|
plant    85 KNHVTFSQKFSKADPLALRLLQRLLAFD---RPTPTEIRSR---DKGHKTRVEIT 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p38aNP_001163711.1 STKc_p38 9..354 CDD:143356 44/120 (37%)
S_TKc 25..312 CDD:214567 40/107 (37%)
AT4G01595NP_680555.2 PKc_like <20..118 CDD:304357 38/100 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0660
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.